data_SASDBT7_MAIN # _sas_result.id 442 _sas_result.SASBDB_code SASDBT7 _sas_result.experimental_MW 186.000 _sas_result.experimental_MW_error . _sas_result.MW_standard 80.950 _sas_result.MW_standard_error 2.800 _sas_result.MW_Porod . _sas_result.MW_Porod_error . _sas_result.I0_from_PR . _sas_result.I0_from_PR_error . _sas_result.I0_from_Guinier 146000.0000000000 _sas_result.I0_from_Guinier_error 10100.0000000000 _sas_result.Rg_from_PR . _sas_result.Rg_from_PR_error . _sas_result.Rg_from_Guinier 6.780 _sas_result.Rg_from_Guinier_error 0.641 _sas_result.D_max . _sas_result.Porod_volume . _sas_result.Porod_volume_error . _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min 1 _sas_result.Guinier_point_max 10 _sas_result.type_of_curve single_conc _sas_result.standard . _sas_result.Dmax_error . _sas_result.comments ;From the depositor: "Protein signal is blanked out in 50% sucrose, only DNA contributes to the scattering. Hence, the SAXS profile reports the Rg and molecule weight of the DNA in the nucleosome core particle complex." ; # _sas_scan.title "Nucleosome Core Particle: 1.9 M NaCl, 50% sucrose," _sas_scan.detc_id 19 _sas_scan.id 442 _sas_scan.measurement_date 2014-04-14 _sas_scan.storage_temperature . _sas_scan.cell_temperature 20.0 _sas_scan.exposure_time 0.010 _sas_scan.number_of_frames 5 _sas_scan.unit 1/A _sas_scan.qmin 0.0060 _sas_scan.qmax 0.1950 _sas_scan.sample_id 400 _sas_scan.result_id 442 _sas_scan.beam_id 38 # _sas_beam.id 38 _sas_beam.instrument_name "Advanced Photon Source (APS) BioCAT 18ID" _sas_beam.instrument_city "Argonne, IL" _sas_beam.instrument_country USA _sas_beam.shape . _sas_beam.type_of_source "X-ray synchrotron" _sas_beam.radiation_wavelength 0.125000 _sas_beam.dist_spec_to_detc 2.50000 # _sas_detc.id 19 _sas_detc.name "Pilatus 100K" _sas_detc.type . _sas_detc.pixsize_x 172.000 # _sas_sample.id 400 _sas_sample.name "Nucleosome Core Particle: 1.9 M NaCl, 50% sucrose, 50ms - 10s time resolved data" _sas_sample.ext_coefficient . _sas_sample.contrast . _sas_sample.specific_vol . _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration 2.00 _sas_sample.concentration_method . loop_ _sas_sample.entity_id 445 446 447 # _sas_buffer.id 220 _sas_buffer.name "20 mM Tris-Cl, 0.1 mM EDTA, 0.1 mM DTT, 50% sucrose, 1.9 M NaCl" _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.500 _sas_buffer.comment . _sas_buffer.composition . _sas_buffer.sample_id 400 # loop_ _entity.id _entity.type _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules 445 protein "Nucleasome Core Particle with Widom 601 DNA - HISTONE H2A-H2B Heterodimer" 23.754 2 446 protein "Nucleasome Core Particle with Widom 601 DNA - HISTONE H3-H4 Heterodimer" 23.168 2 447 DNA "Nucleasome Core Particle with Widom 601 DNA - dsDNA" 92.093 1 # loop_ _entity_name_com.entity_id _entity_name_com.name 445 . 446 . 447 . # loop_ _entity_poly.entity_id _entity_poly.pdbx_seq_one_letter_code 445 ;GKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK ; 446 ;LATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG ; 447 ;ATCGGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCGAT ATCGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCCGAT ; # loop_ _entity_src_gen.entity_id _entity_src_gen.gene_src_common_name 445 "Xenopus laevis" 446 "Xenopus laevis" 447 "Xenopus laevis" # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code 1 445 UniProt . 2 446 UniProt . 3 447 UniProt . # _citation.id 231 _citation.title "Asymmetric unwrapping of nucleosomal DNA propagates asymmetric opening and dissociation of the histone core." _citation.year "2017 Jan 10" _citation.pdbx_database_id_DOI 10.1073/pnas.1611118114 _citation.pdbx_database_id_PubMed 28028239 _citation.journal_abbrev "Proc Natl Acad Sci U S A" _citation.journal_volume 114 _citation.journal_issue 2 _citation.page_first 334 _citation.page_last 339 # loop_ _citation_author.citation_id _citation_author.ordinal _citation_author.name 231 1 "Chen Y" 231 2 "Tokuda JM" 231 3 "Topping T" 231 4 "Meisburger SP" 231 5 "Pabit SA" 231 6 "Gloss LM" # _pdbx_contact_author.id 113 _pdbx_contact_author.name_first Yujie _pdbx_contact_author.name_last Chen _pdbx_contact_author.role . _pdbx_contact_author.address_1 . _pdbx_contact_author.address_2 "Cornell University" _pdbx_contact_author.address_3 "Ithaca, NY, United States" # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 6.000000E-03 8.629612E+04 3.588077E+04 442 2 7.500000E-03 1.407164E+05 1.938365E+04 442 3 9.000000E-03 1.274883E+05 1.345309E+04 442 4 1.050000E-02 9.166093E+04 1.055741E+04 442 5 1.200000E-02 1.314516E+05 8.834226E+03 442 6 1.350000E-02 1.087268E+05 7.901257E+03 442 7 1.500000E-02 1.057882E+05 7.267561E+03 442 8 1.650000E-02 1.003820E+05 7.147935E+03 442 9 1.800000E-02 8.790135E+04 6.761560E+03 442 10 1.950000E-02 7.772939E+04 6.438881E+03 442 11 2.100000E-02 5.605886E+04 6.271954E+03 442 12 2.250000E-02 6.186652E+04 6.420272E+03 442 13 2.400000E-02 6.062878E+04 6.615929E+03 442 14 2.550000E-02 7.370093E+04 6.469558E+03 442 15 2.700000E-02 5.840348E+04 6.462045E+03 442 16 2.850000E-02 3.270508E+04 6.254886E+03 442 17 3.000000E-02 5.739747E+04 6.252294E+03 442 18 3.150000E-02 3.347529E+04 6.130179E+03 442 19 3.300000E-02 3.664665E+04 5.966140E+03 442 20 3.450000E-02 3.660922E+04 5.969716E+03 442 21 3.600000E-02 3.954738E+04 5.824864E+03 442 22 3.750000E-02 2.866300E+04 5.703907E+03 442 23 3.900000E-02 2.713263E+04 5.705635E+03 442 24 4.050000E-02 2.361276E+04 5.582305E+03 442 25 4.200000E-02 2.378000E+04 5.592371E+03 442 26 4.350000E-02 3.320053E+04 5.488461E+03 442 27 4.500000E-02 1.723575E+04 5.379673E+03 442 28 4.650000E-02 2.836287E+04 5.381405E+03 442 29 4.800000E-02 2.415030E+04 5.282682E+03 442 30 4.950000E-02 2.069733E+04 5.254678E+03 442 31 5.100000E-02 1.986581E+04 5.145841E+03 442 32 5.250000E-02 1.850929E+04 5.185816E+03 442 33 5.400000E-02 1.611513E+04 5.008146E+03 442 34 5.550000E-02 1.949966E+04 5.058980E+03 442 35 5.700000E-02 8.495017E+03 4.946677E+03 442 36 5.850000E-02 1.647423E+04 4.927245E+03 442 37 6.000000E-02 2.415179E+04 4.934696E+03 442 38 6.150000E-02 2.070691E+04 5.208373E+03 442 39 6.300000E-02 6.333712E+03 5.398877E+03 442 40 6.450000E-02 1.216460E+04 5.517791E+03 442 41 6.600000E-02 1.915892E+04 5.583288E+03 442 42 6.750000E-02 8.587839E+03 5.612751E+03 442 43 6.900000E-02 1.375825E+04 5.625565E+03 442 44 7.050000E-02 1.460288E+04 5.743709E+03 442 45 7.200000E-02 7.022779E+03 5.673412E+03 442 46 7.350000E-02 1.397378E+04 5.772602E+03 442 47 7.500000E-02 2.161625E+04 5.865915E+03 442 48 7.650000E-02 1.181220E+04 5.783052E+03 442 49 7.800000E-02 2.114935E+04 5.834125E+03 442 50 7.950000E-02 1.929306E+04 5.812677E+03 442 51 8.100000E-02 1.196429E+04 5.875782E+03 442 52 8.250000E-02 1.218663E+04 5.842413E+03 442 53 8.400000E-02 6.596639E+03 5.843333E+03 442 54 8.550000E-02 1.451113E+04 5.926230E+03 442 55 8.700000E-02 1.138617E+04 5.844932E+03 442 56 8.850000E-02 1.705753E+04 5.835111E+03 442 57 9.000000E-02 9.157124E+03 5.825009E+03 442 58 9.150000E-02 -4.629380E+03 5.857795E+03 442 59 9.300000E-02 -1.123682E+03 5.881074E+03 442 60 9.450000E-02 1.352846E+04 5.943902E+03 442 61 9.600000E-02 1.108354E+04 5.947333E+03 442 62 9.750000E-02 1.295098E+04 5.927817E+03 442 63 9.900000E-02 1.093995E+04 6.014619E+03 442 64 1.005000E-01 -1.715433E+03 5.869755E+03 442 65 1.020000E-01 7.874612E+03 5.990920E+03 442 66 1.035000E-01 3.567525E+03 5.960742E+03 442 67 1.050000E-01 6.909266E+03 5.936359E+03 442 68 1.065000E-01 -7.212302E+02 6.012573E+03 442 69 1.080000E-01 1.428475E+04 5.966539E+03 442 70 1.095000E-01 3.400040E+03 6.027796E+03 442 71 1.110000E-01 3.987933E+03 5.985139E+03 442 72 1.125000E-01 1.449063E+04 5.964490E+03 442 73 1.140000E-01 3.460778E+03 5.847345E+03 442 74 1.155000E-01 5.437158E+03 5.915896E+03 442 75 1.170000E-01 -3.666733E+03 5.941728E+03 442 76 1.185000E-01 7.959876E+03 5.995276E+03 442 77 1.200000E-01 3.863681E+02 5.972550E+03 442 78 1.215000E-01 3.372139E+03 5.957674E+03 442 79 1.230000E-01 -2.782472E+03 5.928444E+03 442 80 1.245000E-01 1.943218E+03 6.036791E+03 442 81 1.260000E-01 4.572800E+03 5.981569E+03 442 82 1.275000E-01 2.124697E+03 6.005627E+03 442 83 1.290000E-01 -5.877244E+03 5.938929E+03 442 84 1.305000E-01 1.002586E+04 6.059604E+03 442 85 1.320000E-01 3.706349E+03 6.013361E+03 442 86 1.335000E-01 -1.507717E+03 5.971513E+03 442 87 1.350000E-01 3.782881E+03 6.076430E+03 442 88 1.365000E-01 -1.142072E+03 5.982543E+03 442 89 1.380000E-01 -5.651172E+03 5.966919E+03 442 90 1.395000E-01 6.070434E+03 5.909457E+03 442 91 1.410000E-01 2.877861E+03 5.972116E+03 442 92 1.425000E-01 -5.215195E+03 6.015782E+03 442 93 1.440000E-01 -4.416123E+02 5.995323E+03 442 94 1.455000E-01 2.998374E+03 6.119800E+03 442 95 1.470000E-01 -1.099961E+03 5.981830E+03 442 96 1.485000E-01 -5.461771E+03 6.036953E+03 442 97 1.500000E-01 -1.081219E+04 6.048073E+03 442 98 1.515000E-01 -2.979336E+03 6.021143E+03 442 99 1.530000E-01 1.546601E+03 6.073745E+03 442 100 1.545000E-01 -7.673413E+03 5.988252E+03 442 101 1.560000E-01 1.017600E+04 6.130765E+03 442 102 1.575000E-01 1.384236E+03 5.987754E+03 442 103 1.590000E-01 -2.028293E+03 6.029831E+03 442 104 1.605000E-01 -2.326763E+02 6.142450E+03 442 105 1.620000E-01 6.452447E+03 6.013027E+03 442 106 1.635000E-01 1.425506E+03 6.062542E+03 442 107 1.650000E-01 -6.689919E+03 5.854484E+03 442 108 1.665000E-01 3.221884E+02 6.052773E+03 442 109 1.680000E-01 -2.020610E+02 6.067176E+03 442 110 1.695000E-01 -4.482416E+03 6.028987E+03 442 111 1.710000E-01 -2.027755E+04 6.024790E+03 442 112 1.725000E-01 9.017485E+03 6.016710E+03 442 113 1.740000E-01 -1.001850E+04 6.059308E+03 442 114 1.755000E-01 8.923638E+03 6.009023E+03 442 115 1.770000E-01 2.730204E+03 6.079529E+03 442 116 1.785000E-01 -7.708628E+02 6.064180E+03 442 117 1.800000E-01 -7.295918E+03 6.019144E+03 442 118 1.815000E-01 -4.893114E+03 6.073866E+03 442 119 1.830000E-01 3.186585E+03 5.983952E+03 442 120 1.845000E-01 4.667277E+03 6.099962E+03 442 121 1.860000E-01 9.700201E+03 6.078545E+03 442 122 1.875000E-01 6.023275E+03 6.079744E+03 442 123 1.890000E-01 -2.885673E+03 6.116326E+03 442 124 1.905000E-01 -7.226481E+03 7.876499E+03 442 125 1.920000E-01 2.370487E+03 9.730364E+03 442 126 1.935000E-01 -6.262887E+03 1.149110E+04 442 127 1.950000E-01 9.030240E+03 1.371589E+04 442 #