{
  "code": "SASDZT8",
  "status": "Published",
  "type_of_curve": "Merged",
  "angular_unit": "1/A",
  "project": {
    "title": "Integrated analysis with iCM-SANS, SAXS and MD simulations for dynamics of multi-domain proteins",
    "publication": {
      "title": "Integrated analysis with iCM-SANS, SAXS and MD simulations for dynamics of multi-domain proteins",
      "author_list": "Okuda A, Inoue R, Kurokawa M, Martel A, Porcar L, Osaki R, Fukuzawa K, Weiss K, Pingali S, Urade R, Sugiyama M",
      "journal": "Journal of Applied Crystallography",
      "doi": "10.1107/S1600576726005832",
      "pmid": null,
      "published_date": "2026 Jul 29"
    },
    "status": "released",
    "submitted_date": "2026-05-20",
    "released_date": "2026-08-05"
  },
  "pddf_data": null,
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDZT8.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZT8_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZT8_kratky_img.png",
  "pddf_plot": null,
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZT8_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDZT8.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "HyPix-6000",
        "resolution": 100.0
      },
      "name": "KURNS",
      "city": "Osaka",
      "country": "Japan",
      "beamline_name": "Rigaku NANOPIX",
      "beam_geometry": null,
      "type_of_source": "X-ray in house",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "human protein disulfide-isomerase A3",
          "short_name": null,
          "sequence": "SDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL",
          "organism": "Homo sapiens",
          "uniprot_code": "P30101",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHC\nKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT\nADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRD\nNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENI\nFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFA\nVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGN\nLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG\nEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYL\nQREATNPPVIQEEKPKKKKKAQEDL",
          "mw": 54.265,
          "total_mw": 54.265,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": ""
        }
      ],
      "buffer": {
        "name": "20 mM Tris-HCl buffer, 150 mM NaCl, 1mM CaCl2",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Wild-type version of human protein disulfide-isomerase A3 (ER-60 h(WT))",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "Kyoto University",
            "webpage": null
          }
        ],
        "contributor_name": "Aya",
        "contributor_surname": "Okuda",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2024-09-27",
    "storage_temperature": 4.0,
    "cell_temperature": 25.0,
    "exposure_time": 300.0,
    "number_of_frames": 72,
    "wavelength": 1.54182,
    "sample_detector_distance": 1.33,
    "concentration_min": 4.0,
    "concentration_max": 4.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.061,
    "s_max": 8.104,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": null,
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": "Two sample-to-detector distance (SDD) conditions, 1330 mm and 300 mm, were used to cover a q range (0.01-0.70 Å-1). Scattering profiles were recorded as 300 s frames, and 72 and 120 frames merged for low q (0.01-0.06 Å-1) and high q (0.06-0.70 Å-1) setups, respectively. We applied the AUC-SAS method to remove aggregation components from the profile.",
  "experiment_description": null,
  "tags": [],
  "intensity_unit": "1/cm",
  "experimental_mw": 40.558,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": null,
  "pddf_i0_error": null,
  "guinier_i0": 0.0377635,
  "guinier_i0_error": null,
  "pddf_rg": null,
  "pddf_rg_error": null,
  "guinier_rg": 3.203,
  "guinier_rg_error": 0.028,
  "pddf_dmax": null,
  "pddf_dmax_error": null,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 14,
  "guinier_point_last": 103,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDZT8_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2026-08-05T11:43:21.265632+02:00",
  "bragg_peak": []
}