{
  "code": "SASDYU3",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "Solution characterization of TraW, a regulatory protein of the F plasmid type 4 secretion system",
    "publication": {
      "title": "Solution characterization of TraW, a regulatory protein of the F plasmid type 4 secretion system",
      "author_list": "Rodriguez C, Audette G",
      "journal": "Structural Dynamics",
      "doi": "10.1063/4.0001201",
      "pmid": null,
      "published_date": "2026 Mar 17"
    },
    "status": "released",
    "submitted_date": "2025-12-10",
    "released_date": "2026-03-18"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDYU3.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDYU3.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDYU3_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDYU3_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDYU3_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDYU3_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDYU3.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Eiger2 XE 9M",
        "resolution": 72.0
      },
      "name": "Advanced Photon Source (APS), Argonne National Laboratory",
      "city": "Lemont, IL",
      "country": "USA",
      "beamline_name": "BioCAT 18ID",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "TraW (Δ1-67)",
          "short_name": null,
          "sequence": "LRPPAVPGIGRTEKYGSRLFDPSVRLAADIRDNEGRVFARQGEVMNPLQYVPFNQTLYFINGDDPAQVAWMKRQTPPTLESKIILVQGSIPEMQKSLDSRVYFDQNGVLCQRLGIDQVPARVSAVPGDRFLKVEFIPAEEGRK",
          "organism": "Escherichia coli (strain K12)",
          "uniprot_code": "P18472",
          "uniprot_range_first": 68,
          "uniprot_range_last": 210,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MRCRGLIALLIWGQSVAAADLGTWGDLWPVKEPDMLTVIMQRLTALEQSGEMGRKMDAFK\nERVIRNSLRPPAVPGIGRTEKYGSRLFDPSVRLAADIRDNEGRVFARQGEVMNPLQYVPF\nNQTLYFINGDDPAQVAWMKRQTPPTLESKIILVQGSIPEMQKSLDSRVYFDQNGVLCQRL\nGIDQVPARVSAVPGDRFLKVEFIPAEEGRK",
          "mw": 19.9,
          "total_mw": 19.9,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": ""
        }
      ],
      "buffer": {
        "name": "20 mM HEPES, 100 mM NaCl, 5% glycerol",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "N-terminal truncation mutant, of the conjugative protein of the F plasmid Type IV Secretion System, TraW.",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2022-11-17",
    "storage_temperature": 4.0,
    "cell_temperature": 22.0,
    "exposure_time": 0.7,
    "number_of_frames": 3175,
    "wavelength": 0.1033,
    "sample_detector_distance": 3.7,
    "concentration_min": null,
    "concentration_max": 13.0,
    "sample_volume": 350.0,
    "flow_rate": 0.5,
    "s_min": 0.029,
    "s_max": 4.171,
    "total_exposure_time": null,
    "seccolumn": 3
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDYU3_fit1_model1_img.png",
          "software": "DAMMIN",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "dummy",
          "software_version": "3.2.1",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDYU3_fit1_model1.cif",
          "model_mw": null,
          "bead_radius": null,
          "log": "https://www.sasbdb.org/media/log_files/refine_MUT80.log",
          "symmetry": null,
          "comment": null,
          "user": 1301
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDYU3_fit1_fixed_fit_img.png",
      "software": "DAMMIN",
      "chi_square_value": 1.271,
      "p_value": 0.0859,
      "fit_residual_plot": "SASDYU3_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDYU3_fit1.fir",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/refine_MUT80.log",
      "software_version": "3.2.1",
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "3.2.1",
  "i0_calibration_standard": null,
  "description": "Synchrotron SAXS data from solutions of a N-terminal truncation mutant of TraW in 20 mM HEPES, 100 mM NaCl, 5% glycerol, pH 7 were collected on the BioCAT 18ID beam line at the Advanced Photon Source (APS; Argonne National Laboratory USA) using a Eiger2 XE 9M detector at a sample-detector distance of 3.7 m and at a wavelength of λ = 0.1033 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 350.00 μl sample at 13 mg/ml was injected at a 0.5 ml/min flow rate onto a GE Superdex 75 Increase 10/300 column at 22°C. 3175 successive 0.500 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "experiment_description": "-",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 20.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 20.7,
  "porod_mw_error": null,
  "pddf_i0": 1.613,
  "pddf_i0_error": 0.0017,
  "guinier_i0": 1.6174,
  "guinier_i0_error": null,
  "pddf_rg": 2.18,
  "pddf_rg_error": 0.074,
  "guinier_rg": 2.18,
  "guinier_rg_error": 0.093,
  "pddf_dmax": 8.0,
  "pddf_dmax_error": null,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 13,
  "guinier_point_last": 321,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDYU3_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2026-03-18T13:59:44.111420+01:00",
  "bragg_peak": []
}