data_SASDCU5_MAIN # _sas_result.id 635 _sas_result.SASBDB_code SASDCU5 _sas_result.experimental_MW 55.000 _sas_result.experimental_MW_error . _sas_result.MW_standard . _sas_result.MW_standard_error . _sas_result.MW_Porod . _sas_result.MW_Porod_error . _sas_result.I0_from_PR . _sas_result.I0_from_PR_error . _sas_result.I0_from_Guinier 794.0000000000 _sas_result.I0_from_Guinier_error . _sas_result.Rg_from_PR . _sas_result.Rg_from_PR_error . _sas_result.Rg_from_Guinier 2.400 _sas_result.Rg_from_Guinier_error . _sas_result.D_max . _sas_result.Porod_volume . _sas_result.Porod_volume_error . _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min . _sas_result.Guinier_point_max . _sas_result.type_of_curve single_conc _sas_result.standard . _sas_result.Dmax_error . _sas_result.comments . # _sas_scan.title "SAXS dilution series on ground Doryteuthis squid lens 100% layer" _sas_scan.detc_id 10 _sas_scan.id 635 _sas_scan.measurement_date 2013-11-12 _sas_scan.storage_temperature . _sas_scan.cell_temperature . _sas_scan.exposure_time . _sas_scan.number_of_frames . _sas_scan.unit 1/A _sas_scan.qmin 0.0080 _sas_scan.qmax 1.7200 _sas_scan.sample_id 593 _sas_scan.result_id 635 _sas_scan.beam_id 16 # _sas_beam.id 16 _sas_beam.instrument_name "National Synchrotron Light Source (NSLS) X9A" _sas_beam.instrument_city "Brookhaven, NY" _sas_beam.instrument_country USA _sas_beam.shape . _sas_beam.type_of_source "X-ray synchrotron" _sas_beam.radiation_wavelength 0.100000 _sas_beam.dist_spec_to_detc . # _sas_detc.id 10 _sas_detc.name "Pilatus 300K" _sas_detc.type 20Hz _sas_detc.pixsize_x . # _sas_sample.id 593 _sas_sample.name "SAXS dilution series on ground Doryteuthis squid lens 100% layer" _sas_sample.ext_coefficient . _sas_sample.contrast . _sas_sample.specific_vol . _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration . _sas_sample.concentration_method . _sas_sample.entity_id 672 # _sas_buffer.id 389 _sas_buffer.name "PBS, phosphate buffered saline" _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.000 _sas_buffer.comment . _sas_buffer.composition . _sas_buffer.sample_id 593 # _entity.id 672 _entity.type protein _entity.pdbx_description "S-crystallin, Q25367_DOROP" _entity.formula_weight 27.289 _entity.pdbx_number_of_molecules 2 # _entity_name_com.entity_id 672 _entity_name_com.name "S-crystallin, Q25367" # _entity_poly.entity_id 672 _entity_poly.pdbx_seq_one_letter_code ;MPTYTLYYFNGRGRAEVLRMMFAAANVKYMDKRFEFNEWDKYRKDMPSMCVPVLEMDGGN KMPETMAIPRYLAREFGFYGKSNMDMMRCDYIADCFYEIMHDYMRYFHEKNGRFRSSMEG SGNGMNSPTGASGDMNSNSNFDTYLQWRFMNTCNRVLPFLERTLEMQNGGKAFFMGDQMM WCDMMCHCALEGPFMENQSMLSKHPKLMALRTRIASHPKISGYLKSRSNTNW ; # _entity_src_gen.entity_id 672 _entity_src_gen.gene_src_common_name "Doryteuthis pealeii" # _struct_ref.id 1 _struct_ref.entity_id 672 _struct_ref.db_name UniProt _struct_ref.db_code Q25367_DOR _struct_ref.details http://www.uniprot.org/uniprot/Q25367_DOR # _citation.id 269 _citation.title "Eye patches: Protein assembly of index-gradient squid lenses." _citation.year "2017 Aug 11" _citation.pdbx_database_id_DOI 10.1126/science.aal2674 _citation.pdbx_database_id_PubMed 28798124 _citation.journal_abbrev Science _citation.journal_volume 357 _citation.journal_issue 6351 _citation.page_first 564 _citation.page_last 569 # loop_ _citation_author.citation_id _citation_author.ordinal _citation_author.name 269 1 "Cai J" 269 2 "Townsend JP" 269 3 "Dodson TC" 269 4 "Heiney PA" # _pdbx_contact_author.id 162 _pdbx_contact_author.name_first Jing _pdbx_contact_author.name_last Cai _pdbx_contact_author.role . _pdbx_contact_author.address_1 Penn _pdbx_contact_author.address_2 "University of Pennsylvania" _pdbx_contact_author.address_3 "Philadelphia, PA, United States" # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 8.000000E-03 7.369758E+03 7.478780E+01 635 2 9.000000E-03 6.744645E+03 6.123129E+01 635 3 1.000000E-02 6.126752E+03 4.972907E+01 635 4 1.100000E-02 5.505544E+03 4.069972E+01 635 5 1.200000E-02 4.988595E+03 3.230689E+01 635 6 1.300000E-02 4.503190E+03 2.766646E+01 635 7 1.400000E-02 4.030645E+03 2.467920E+01 635 8 1.500000E-02 3.575643E+03 2.033173E+01 635 9 1.600000E-02 3.168454E+03 1.770449E+01 635 10 1.700000E-02 2.806571E+03 1.611008E+01 635 11 1.800000E-02 2.493244E+03 1.463350E+01 635 12 1.900000E-02 2.197904E+03 1.266666E+01 635 13 2.000000E-02 1.933945E+03 1.104521E+01 635 14 2.100000E-02 1.711420E+03 9.763330E+00 635 15 2.200000E-02 1.516101E+03 8.294970E+00 635 16 2.300000E-02 1.345743E+03 7.755730E+00 635 17 2.400000E-02 1.203343E+03 7.021420E+00 635 18 2.500000E-02 1.090960E+03 6.279060E+00 635 19 2.600000E-02 9.993283E+02 5.549460E+00 635 20 2.700000E-02 9.191244E+02 4.756120E+00 635 21 2.800000E-02 8.580891E+02 4.334980E+00 635 22 2.900000E-02 8.131665E+02 4.019990E+00 635 23 3.000000E-02 7.754889E+02 3.434520E+00 635 24 3.100000E-02 7.460016E+02 3.278220E+00 635 25 3.200000E-02 7.245917E+02 3.176220E+00 635 26 3.300000E-02 7.064380E+02 3.045810E+00 635 27 3.400000E-02 6.901913E+02 2.921690E+00 635 28 3.500000E-02 6.745105E+02 2.817830E+00 635 29 3.600000E-02 6.611208E+02 2.739250E+00 635 30 3.700000E-02 6.509895E+02 2.682100E+00 635 31 3.800000E-02 6.388420E+02 2.647270E+00 635 32 3.900000E-02 6.265737E+02 2.612410E+00 635 33 4.000000E-02 6.136244E+02 2.558460E+00 635 34 4.100000E-02 6.018387E+02 2.508980E+00 635 35 4.200000E-02 5.908446E+02 2.502410E+00 635 36 4.300000E-02 5.786284E+02 2.399240E+00 635 37 4.400000E-02 5.692362E+02 2.374970E+00 635 38 4.500000E-02 5.548441E+02 2.344370E+00 635 39 4.600000E-02 5.457327E+02 2.261030E+00 635 40 4.700000E-02 5.334251E+02 2.275080E+00 635 41 4.800000E-02 5.235359E+02 2.584390E+00 635 42 4.900000E-02 5.152751E+02 2.227360E+00 635 43 5.025000E-02 5.020135E+02 1.768440E+00 635 44 5.200000E-02 4.830598E+02 1.611400E+00 635 45 5.400000E-02 4.638435E+02 1.564050E+00 635 46 5.600000E-02 4.446196E+02 1.521910E+00 635 47 5.800000E-02 4.263705E+02 1.521540E+00 635 48 6.000000E-02 4.092287E+02 1.474690E+00 635 49 6.200000E-02 3.912816E+02 1.463440E+00 635 50 6.400000E-02 3.733423E+02 1.372840E+00 635 51 6.600000E-02 3.552568E+02 1.365280E+00 635 52 6.800000E-02 3.399631E+02 1.339880E+00 635 53 7.000000E-02 3.231374E+02 1.298220E+00 635 54 7.200000E-02 3.092045E+02 1.269400E+00 635 55 7.400000E-02 2.934771E+02 1.212990E+00 635 56 7.600000E-02 2.788210E+02 1.188700E+00 635 57 7.800000E-02 2.639157E+02 1.165100E+00 635 58 8.000000E-02 2.497011E+02 1.113170E+00 635 59 8.200000E-02 2.358454E+02 1.094560E+00 635 60 8.400000E-02 2.228862E+02 1.065240E+00 635 61 8.600000E-02 2.101205E+02 1.058600E+00 635 62 8.800000E-02 1.971799E+02 1.008960E+00 635 63 9.000000E-02 1.853476E+02 1.004310E+00 635 64 9.200000E-02 1.737922E+02 9.666200E-01 635 65 9.400000E-02 1.627553E+02 9.459400E-01 635 66 9.600000E-02 1.537307E+02 1.163370E+00 635 67 9.800000E-02 1.448583E+02 8.880900E-01 635 68 1.007500E-01 1.298925E+02 6.477500E-01 635 69 1.050000E-01 1.085270E+02 5.903100E-01 635 70 1.100000E-01 8.848566E+01 5.220300E-01 635 71 1.150000E-01 7.274966E+01 3.378180E+00 635 72 1.200000E-01 5.752590E+01 2.176570E+00 635 73 1.250000E-01 4.490338E+01 1.058230E+00 635 74 1.300000E-01 3.445066E+01 1.241450E+00 635 75 1.350000E-01 2.626351E+01 1.342120E+00 635 76 1.400000E-01 1.996546E+01 1.680880E+00 635 77 1.450000E-01 1.514178E+01 1.764100E+00 635 78 1.500000E-01 1.163292E+01 2.042700E+00 635 79 1.550000E-01 9.152680E+00 2.152050E+00 635 80 1.600000E-01 6.619370E+00 2.723700E-01 635 81 1.650000E-01 5.814110E+00 2.364100E-01 635 82 1.700000E-01 5.421160E+00 2.168800E-01 635 83 1.750000E-01 5.438610E+00 1.925300E-01 635 84 1.800000E-01 5.431280E+00 1.811000E-01 635 85 1.850000E-01 5.569200E+00 1.588600E-01 635 86 1.900000E-01 5.799710E+00 1.518200E-01 635 87 1.950000E-01 5.918390E+00 1.554300E-01 635 88 2.000000E-01 6.070200E+00 1.353000E-01 635 89 2.050000E-01 6.038610E+00 1.720700E-01 635 90 2.100000E-01 5.863830E+00 1.501600E-01 635 91 2.150000E-01 5.737640E+00 1.548200E-01 635 92 2.200000E-01 5.514380E+00 1.269900E-01 635 93 2.250000E-01 5.242880E+00 1.313000E-01 635 94 2.300000E-01 4.841270E+00 1.206100E-01 635 95 2.350000E-01 4.459610E+00 1.594400E-01 635 96 2.400000E-01 4.037370E+00 1.171300E-01 635 97 2.450000E-01 3.689260E+00 1.156300E-01 635 98 2.500000E-01 3.496950E+00 1.182300E-01 635 99 2.550000E-01 3.173710E+00 1.421600E-01 635 100 2.600000E-01 3.018550E+00 1.295900E-01 635 101 2.650000E-01 2.848590E+00 1.421400E-01 635 102 2.700000E-01 2.716280E+00 1.557100E-01 635 103 2.750000E-01 2.636120E+00 1.240300E-01 635 104 2.800000E-01 2.560210E+00 1.429400E-01 635 105 2.850000E-01 2.544450E+00 1.686500E-01 635 106 2.900000E-01 2.599370E+00 1.297900E-01 635 107 2.950000E-01 2.651890E+00 1.114500E-01 635 108 3.000000E-01 2.689730E+00 9.675000E-02 635 109 3.050000E-01 2.621940E+00 1.019300E-01 635 110 3.100000E-01 2.636730E+00 1.178000E-01 635 111 3.150000E-01 2.589320E+00 1.311400E-01 635 112 3.200000E-01 2.577300E+00 1.152900E-01 635 113 3.250000E-01 2.566820E+00 1.919900E-01 635 114 3.300000E-01 2.500710E+00 1.259000E-01 635 115 3.350000E-01 2.411360E+00 1.783400E-01 635 116 3.400000E-01 2.409990E+00 1.057100E-01 635 117 3.450000E-01 2.333090E+00 1.390700E-01 635 118 3.500000E-01 2.172850E+00 1.263100E-01 635 119 3.550000E-01 2.103980E+00 1.096000E-01 635 120 3.600000E-01 2.079370E+00 1.232300E-01 635 121 3.650000E-01 2.039300E+00 1.115900E-01 635 122 3.700000E-01 1.977270E+00 9.681000E-02 635 123 3.750000E-01 2.080730E+00 9.453000E-02 635 124 3.800000E-01 2.138660E+00 9.466000E-02 635 125 3.850000E-01 2.147360E+00 9.331000E-02 635 126 3.900000E-01 2.193620E+00 9.513000E-02 635 127 3.950000E-01 2.283990E+00 1.153000E-01 635 128 4.000000E-01 2.364630E+00 1.356300E-01 635 129 4.050000E-01 2.364160E+00 9.975000E-02 635 130 4.100000E-01 2.407930E+00 1.100500E-01 635 131 4.150000E-01 2.491630E+00 1.488100E-01 635 132 4.200000E-01 2.589320E+00 9.667000E-02 635 133 4.250000E-01 2.615710E+00 9.868000E-02 635 134 4.300000E-01 2.725220E+00 1.185900E-01 635 135 4.350000E-01 2.785840E+00 1.040000E-01 635 136 4.400000E-01 2.829680E+00 8.387000E-02 635 137 4.450000E-01 2.846190E+00 1.307800E-01 635 138 4.500000E-01 2.869370E+00 9.657000E-02 635 139 4.550000E-01 2.963110E+00 9.391000E-02 635 140 4.600000E-01 3.012080E+00 9.034000E-02 635 141 4.650000E-01 2.996230E+00 1.052500E-01 635 142 4.700000E-01 3.103660E+00 9.798000E-02 635 143 4.750000E-01 3.139790E+00 8.849000E-02 635 144 4.800000E-01 3.150460E+00 9.771000E-02 635 145 4.850000E-01 3.188050E+00 8.650000E-02 635 146 4.900000E-01 3.217190E+00 1.107800E-01 635 147 4.950000E-01 3.202670E+00 9.171000E-02 635 148 5.012500E-01 3.264850E+00 6.911000E-02 635 149 5.100000E-01 3.330740E+00 1.515700E-01 635 150 5.200000E-01 3.357340E+00 6.551000E-02 635 151 5.300000E-01 3.346940E+00 7.421000E-02 635 152 5.400000E-01 3.345290E+00 6.801000E-02 635 153 5.500000E-01 3.233380E+00 6.582000E-02 635 154 5.600000E-01 3.149700E+00 7.267000E-02 635 155 5.700000E-01 3.024530E+00 7.873000E-02 635 156 5.800000E-01 2.907010E+00 6.925000E-02 635 157 5.900000E-01 2.761820E+00 6.137000E-02 635 158 6.000000E-01 2.616470E+00 6.204000E-02 635 159 6.100000E-01 2.496840E+00 6.012000E-02 635 160 6.200000E-01 2.434490E+00 7.647000E-02 635 161 6.300000E-01 2.426280E+00 9.102000E-02 635 162 6.400000E-01 2.370860E+00 6.169000E-02 635 163 6.500000E-01 2.332280E+00 6.733000E-02 635 164 6.600000E-01 2.273870E+00 6.902000E-02 635 165 6.700000E-01 2.215940E+00 7.961000E-02 635 166 6.800000E-01 2.157200E+00 1.059400E-01 635 167 6.900000E-01 2.090230E+00 6.033000E-02 635 168 7.000000E-01 1.972570E+00 6.036000E-02 635 169 7.100000E-01 1.858290E+00 5.983000E-02 635 170 7.200000E-01 1.723300E+00 7.931000E-02 635 171 7.300000E-01 1.640840E+00 5.712000E-02 635 172 7.400000E-01 1.551550E+00 3.002900E-01 635 173 7.500000E-01 1.513910E+00 6.137000E-02 635 174 7.600000E-01 1.449400E+00 7.057000E-02 635 175 7.700000E-01 1.384320E+00 1.152600E-01 635 176 7.800000E-01 1.374160E+00 6.353000E-02 635 177 7.900000E-01 1.352370E+00 6.461000E-02 635 178 8.000000E-01 1.268360E+00 9.555000E-02 635 179 8.100000E-01 1.254010E+00 7.296000E-02 635 180 8.200000E-01 1.237480E+00 1.058200E-01 635 181 8.300000E-01 1.230570E+00 8.359000E-02 635 182 8.400000E-01 1.180120E+00 7.736000E-02 635 183 8.500000E-01 1.107700E+00 7.290000E-02 635 184 8.600000E-01 1.087340E+00 7.930000E-02 635 185 8.700000E-01 1.063900E+00 7.686000E-02 635 186 8.800000E-01 1.036170E+00 7.459000E-02 635 187 8.900000E-01 1.003440E+00 6.805000E-02 635 188 9.000000E-01 9.648700E-01 7.753000E-02 635 189 9.100000E-01 9.229800E-01 8.372000E-02 635 190 9.200000E-01 9.767900E-01 6.919000E-02 635 191 9.300000E-01 9.652900E-01 6.934000E-02 635 192 9.400000E-01 1.004410E+00 1.575300E-01 635 193 9.500000E-01 9.710300E-01 7.294000E-02 635 194 9.600000E-01 1.004010E+00 6.666000E-02 635 195 9.700000E-01 1.001600E+00 6.624000E-02 635 196 9.800000E-01 9.713900E-01 1.012600E-01 635 197 9.900000E-01 1.013570E+00 7.665000E-02 635 198 1.005000E+00 9.827100E-01 5.887000E-02 635 199 1.030000E+00 1.000810E+00 5.196000E-02 635 200 1.060000E+00 1.002530E+00 5.310000E-02 635 201 1.090000E+00 1.013290E+00 5.979000E-02 635 202 1.120000E+00 1.039450E+00 7.439000E-02 635 203 1.150000E+00 1.069320E+00 6.352000E-02 635 204 1.180000E+00 1.116490E+00 8.158000E-02 635 205 1.210000E+00 1.228080E+00 6.534000E-02 635 206 1.240000E+00 1.271520E+00 1.237100E-01 635 207 1.270000E+00 1.321350E+00 7.765000E-02 635 208 1.300000E+00 1.348290E+00 7.069000E-02 635 209 1.330000E+00 1.325160E+00 7.196000E-02 635 210 1.360000E+00 1.321990E+00 7.479000E-02 635 211 1.390000E+00 1.274340E+00 7.074000E-02 635 212 1.420000E+00 1.202150E+00 6.621000E-02 635 213 1.450000E+00 1.135500E+00 6.403000E-02 635 214 1.480000E+00 9.639200E-01 5.720000E-02 635 215 1.510000E+00 8.748300E-01 6.070000E-02 635 216 1.540000E+00 6.781300E-01 6.149000E-02 635 217 1.570000E+00 6.047200E-01 6.020000E-02 635 218 1.600000E+00 5.379200E-01 1.786300E-01 635 219 1.630000E+00 4.207700E-01 6.675000E-02 635 220 1.660000E+00 2.850400E-01 7.069000E-02 635 221 1.690000E+00 1.747600E-01 6.175000E-02 635 222 1.720000E+00 1.000000E-02 5.734000E-02 635 #