{
  "code": "SASDUU6",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "Phase separation of a microtubule plus-end tracking protein into a fluid fractal network",
    "publication": {
      "title": "Phase separation of a microtubule plus-end tracking protein into a fluid fractal network",
      "author_list": "Czub M, Uliana F, Grubić T, Padeste C, Rosowski K, Dufresne E, Menzel A, Vakonakis I, Gasser U, Steinmetz M",
      "journal": null,
      "doi": "10.1101/2024.04.19.590270",
      "pmid": null,
      "published_date": "2024 Apr 19"
    },
    "status": "released",
    "submitted_date": "2024-04-06",
    "released_date": "2024-07-15"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDUU6.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDUU6.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUU6_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUU6_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDUU6_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUU6_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDUU6.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Eiger 4M",
        "resolution": 75.0
      },
      "name": "Diamond Light Source",
      "city": "Didcot",
      "country": "UK",
      "beamline_name": "B21",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Nuclear fusion protein BIK1",
          "short_name": "Bik1 CC",
          "sequence": "MAHHHHHHSAALEVLFQGPDNGHMNDLNSSEVTIELREAQLTIEKLQRKQLHYKRLLDDQRMVLEEVQPTFDRYEATIQEREKEIDHLKQQLELERRQQAKQKQFFDAENEQLLAVVSQLHEEIKENEERNLSHNQPTGANEDVELLKKQLEQLRNIEDQFELHKTKWAKEREQLKMHNDSLSKEYQNLSKELFLTKPQDSSSEEVASLTKKLEEANEKIKQLEQAQAQTAVES",
          "organism": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c)",
          "uniprot_code": "P11709",
          "uniprot_range_first": 182,
          "uniprot_range_last": 389,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MDRYQRKIGCFIQIPNLGRGQLKYVGPVDTKAGMFAGVDLLANIGKNDGSFMGKKYFQTE\nYPQSGLFIQLQKVASLIEKASISQTSRRTTMEPLSIPKNRSIVRLTNQFSPMDDPKSPTP\nMRSFRITSRHSGNQQSMDQEASDHHQQQEFGYDNREDRMEVDSILSSDRKANHNTTSDWK\nPDNGHMNDLNSSEVTIELREAQLTIEKLQRKQLHYKRLLDDQRMVLEEVQPTFDRYEATI\nQEREKEIDHLKQQLELERRQQAKQKQFFDAENEQLLAVVSQLHEEIKENEERNLSHNQPT\nGANEDVELLKKQLEQLRNIEDQFELHKTKWAKEREQLKMHNDSLSKEYQNLSKELFLTKP\nQDSSSEEVASLTKKLEEANEKIKQLEQAQAQTAVESLPIFDPPAPVDTTAGRQQWCEHCD\nTMGHNTAECPHHNPDNQQFF",
          "mw": 27.655,
          "total_mw": 55.31,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "The protein construct used for SAXS contains an additional polyhistidine tag and non-native amino acid extension at the N-terminus (MAHHHHHHSAALEVLFQGP)."
        }
      ],
      "buffer": {
        "name": "20 mM Tris-HCl pH 7.5, 500 mM NaCl, 2% glycerol, 1 mM DTT",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": null,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Nuclear fusion protein BIK1 coiled-coil in a high salt buffer",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "Paul Scherrer Institut",
            "webpage": null
          }
        ],
        "contributor_name": "Mateusz",
        "contributor_surname": "Czub",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2023-07-13",
    "storage_temperature": 15.0,
    "cell_temperature": 15.0,
    "exposure_time": 3.2,
    "number_of_frames": 37,
    "wavelength": 0.09464,
    "sample_detector_distance": 3.7197,
    "concentration_min": null,
    "concentration_max": 6.0,
    "sample_volume": 50.0,
    "flow_rate": 0.16,
    "s_min": 0.045,
    "s_max": 3.4,
    "total_exposure_time": null,
    "seccolumn": 43
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDUU6_fit1_model1_img.png",
          "software": "DAMFILT",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "dummy",
          "software_version": "DAMFILT 5.0 (r12736)",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDUU6_fit1_model1.pdb",
          "model_mw": 192.592,
          "bead_radius": 5.5,
          "log": null,
          "symmetry": "P1",
          "comment": null,
          "user": 1053
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDUU6_fit1_fixed_fit_img.png",
      "software": "DAMMIF",
      "chi_square_value": 1.031,
      "p_value": 0.1527,
      "fit_residual_plot": "SASDUU6_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDUU6_fit1.fir",
      "fit_log": null,
      "software_version": null,
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "Note: The ab initio model displayed in this entry represents the bead-occupancy and volume-corrected shape obtained from the spatial alignment of several individual DAM models (DAMFILT) and does not reflect the fit to the displayed data.",
  "experiment_description": "Synchrotron SAXS data from solutions of BIK1 coiled-coil in 20 mM Tris-HCl pH 7.5, 500 mM NaCl, 2% glycerol, 1 mM DTT were collected on the B21 beam line at the Diamond Light Source (Didcot, UK) using a Eiger 4M detector at a sample-detector distance of 3.7 m and at a wavelength of λ = 0.09464 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 50.00 μl sample at 6 mg/ml was injected at a 0.16 ml/min flow rate onto a Shodex KW404-4F column at 15°C. 37 successive 3.200 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 65.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.04183,
  "pddf_i0_error": null,
  "guinier_i0": 0.0422888,
  "guinier_i0_error": null,
  "pddf_rg": 7.97,
  "pddf_rg_error": null,
  "guinier_rg": 8.0,
  "guinier_rg_error": 3.239,
  "pddf_dmax": 27.0,
  "pddf_dmax_error": null,
  "porod_volume": 282.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 21,
  "guinier_point_last": 52,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDUU6_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2024-07-15T07:49:36.995230+02:00",
  "bragg_peak": []
}