{
  "code": "SASDXU7",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/nm",
  "project": {
    "title": "The N-Myc MB0-MBI region interacts specifically and dynamically with the N-lobe of Aurora kinase A.",
    "publication": {
      "title": "The N-Myc MB0-MBI region interacts specifically and dynamically with the N-lobe of Aurora kinase A.",
      "author_list": "Hultman J, Morad V, Tanner E, Kenney TMG, Pietras Z, Khare LP, Derbyshire D, Resetca D, Arrowsmith CH, Aili D, Ekström S, Penn LZ, Wallner B, Ahlner A, Sunnerhagen M",
      "journal": "Nat Commun",
      "doi": "10.1038/s41467-026-69725-1",
      "pmid": "41735282",
      "published_date": "2026 Feb 24"
    },
    "status": "released",
    "submitted_date": "2025-08-19",
    "released_date": "2026-01-30"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDXU7.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXU7.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXU7_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXU7_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDXU7_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXU7_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXU7.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 6M",
        "resolution": null
      },
      "name": "PETRA III",
      "city": "DESY; Hamburg",
      "country": "Germany",
      "beamline_name": "EMBL P12",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "N-myc proto-oncogene protein, residues 1-69",
          "short_name": "N-Myc1-69",
          "sequence": "SMPSCSTSTMP GMICKNPDLE FDSLQPCFYP DEDDFYFGGP DSTPPGEDIW KKFELLPTPP\r\nLSPSRGFAE",
          "organism": "Homo sapiens",
          "uniprot_code": "P04198",
          "uniprot_range_first": 1,
          "uniprot_range_last": 69,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP\nLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGF\nSAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELA\nHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPG\nGRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT\nVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLK\nSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV\nVILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC",
          "mw": 7.766,
          "total_mw": 7.766,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": ""
        }
      ],
      "buffer": {
        "name": "20mM HEPES, 150mM NaCl, 5mM MgCl2, 3% v/v glycerol, 2mM TCEP",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "N-Myc proto-oncogene protein residues 1-69",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "Linköping University ",
            "webpage": null
          }
        ],
        "contributor_name": "Johanna",
        "contributor_surname": "Hultman",
        "orcid": "https://orcid.org/0009-0000-8066-228X"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2023-11-28",
    "storage_temperature": null,
    "cell_temperature": null,
    "exposure_time": null,
    "number_of_frames": null,
    "wavelength": null,
    "sample_detector_distance": null,
    "concentration_min": null,
    "concentration_max": null,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.023,
    "s_max": 4.458,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "Synchrotron SAXS data from solutions of the N-Myc proto-oncogen protein (residues 1-69) was collected in 20mM HEPES, 150mM NaCl, 5mM MgCl2, 3% v/v glycerol, 2mM TCEP, pH 7.5 on the EMBL P12 beam line at PETRA III (DESY, Hamburg, Germany) using a Pilatus 6M detector at a sample-detector distance of 3 m and a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAXS was employed by injecting 70.00 μl sample of 14 mg/ml onto a GE Superdex 75 Increase 10/300 column with a flow rate of 0.70 ml/min at 20°C. 2100 successive 1 second frames were collected. Buffer subtraction was done using CHROMIXS and data analysis was done using the ATSAS suite.",
  "experiment_description": null,
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 6.6,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 7.5,
  "porod_mw_error": null,
  "pddf_i0": 757.3,
  "pddf_i0_error": null,
  "guinier_i0": 744.1,
  "guinier_i0_error": null,
  "pddf_rg": 2.59,
  "pddf_rg_error": null,
  "guinier_rg": 2.375,
  "guinier_rg_error": 0.016,
  "pddf_dmax": 11.0,
  "pddf_dmax_error": null,
  "porod_volume": 12.25,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 22,
  "guinier_point_last": 181,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDXU7_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2026-02-25T14:53:46.995832+01:00",
  "bragg_peak": []
}