{
  "code": "SASDXV2",
  "status": "Published",
  "type_of_curve": "Co-flow SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "New structural insights into the control of the retinoic acid receptors RAR/RXR by DNA, ligands, and transcriptional coregulators.",
    "publication": {
      "title": "New structural insights into the control of the retinoic acid receptors RAR/RXR by DNA, ligands, and transcriptional coregulators.",
      "author_list": "Tambones I, Sagar A, Vankova P, Loginov D, Carivenc C, Rochel N, Bourguet W, Man P, Bernadó P, le Maire A",
      "journal": "Nucleic Acids Res",
      "doi": "10.1093/nar/gkaf967",
      "pmid": "41036627",
      "published_date": "2025 Sep 23"
    },
    "status": "released",
    "submitted_date": "2025-03-19",
    "released_date": "2025-10-13"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDXV2.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXV2.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXV2_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXV2_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDXV2_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXV2_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXV2.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Eiger 4M",
        "resolution": 75.0
      },
      "name": "SOLEIL",
      "city": "Saint-Aubin",
      "country": "France",
      "beamline_name": "SWING",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Retinoic acid receptor alpha",
          "short_name": "RARα",
          "sequence": "GSHMPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLKMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLD",
          "organism": "Mus musculus",
          "uniprot_code": "P11416",
          "uniprot_range_first": 82,
          "uniprot_range_last": 421,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPAT\nIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM\nVYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTL\nTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV\nEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA\nGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALK\nVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL\nDTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP",
          "mw": 39.156,
          "total_mw": 39.156,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "Receptor for retinoic acid (PubMed:17205979). Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes (PubMed:17205979). The RXR/RAR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5 (PubMed:17205979). In the absence of ligand, the RXR-RAR heterodimers associate with a multiprotein complex containing transcription corepressors that induce histone deacetylation, chromatin condensation and transcriptional suppression (By similarity)."
        },
        {
          "long_name": "BMS493 (RAR inverse agonist ligand)",
          "short_name": null,
          "sequence": "C29H24O2",
          "organism": null,
          "uniprot_code": null,
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "other",
          "uniprot_sequence": "",
          "mw": 0.404,
          "total_mw": 0.404,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "MS493 is an inverse pan-retinoic acid receptor (RAR) agonist. BMS493 increases nuclear corepressor interaction with RARs. BMS493 also could prevent retinoic acid-induced differentiation[1][2]. BMS493 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups."
        },
        {
          "long_name": "Retinoid X receptor alpha",
          "short_name": "RXRα",
          "sequence": "GSNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT",
          "organism": "Homo sapiens",
          "uniprot_code": "P19793",
          "uniprot_range_first": 126,
          "uniprot_range_last": 462,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING\nMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP\nAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID\nKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL\nAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL\nLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM\nQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL\nRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT",
          "mw": 38.381,
          "total_mw": 38.381,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "Receptor for retinoic acid that acts as a transcription factor (PubMed:10874028, PubMed:11162439, PubMed:11915042, PubMed:37478846). Forms homo- or heterodimers with retinoic acid receptors (RARs) and binds to target response elements in response to their ligands, all-trans or 9-cis retinoic acid, to regulate gene expression in various biological processes (PubMed:10195690, PubMed:11162439, PubMed:11915042, PubMed:16107141, PubMed:17761950, PubMed:18800767, PubMed:19167885, PubMed:28167758, PubMed:37478846). The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5 to regulate transcription (PubMed:10195690, PubMed:11162439, PubMed:11915042, PubMed:17761950, PubMed:28167758)."
        },
        {
          "long_name": "Inverted Repeat binding site with zero-base-pair spacing",
          "short_name": "IR0",
          "sequence": "gcaGGGTCATGACCCcgc \r\ngtCCCAGTACTGGGgcgc",
          "organism": null,
          "uniprot_code": null,
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "DNA",
          "uniprot_sequence": "",
          "mw": 11.144,
          "total_mw": 11.144,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "Inverted repeat (IR0) retinoid responsive element (RARE) from the Trim16 gene."
        },
        {
          "long_name": "Nuclear receptor corepressor 1",
          "short_name": "NCoR NID",
          "sequence": "GPHMQVPRTHRLITLADHICQIITQDFARNQVPSQPSTSTFQTSPSALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQRSDSRSPGSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDE",
          "organism": "Mus musculus",
          "uniprot_code": "Q60974",
          "uniprot_range_first": 2059,
          "uniprot_range_last": 2325,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSARHQQEFAVPDYRSSHLEVSQASQLLQQQ\nQQQQLRRRPSLLSEFHPGSDRPQERRSGYEQFHPGPSPVDHDSLESKRPRLEQVSDSHFQ\nRISAAVLPLVHTLPEGLRSSANAKKDPAFGVKHEAPSSPLSGQPCGDDQNASPSKLSKEE\nLIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIY\nDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHAR\nKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQ\nRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINM\nNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYL\nTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEEKDD\nKEDSKETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRGKGRVTRSMTSEAAAANAAA\nAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQ\nCKNFYFNYKRRHNLDNLLQQHKQKASRKPREERDVSQCESVASTVSAQEDEDIEASNEEE\nNPEDSEGAENSSDTESAPSPSPVEAAKSSEDSSENAASRGNTEPVAELEATTDPAPCASP\nSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPE\nMQVPENTASKGEGDAKERDLESTSEKTEARDEDVVVAEQIERPEPQSDDDSSATCSADEG\nVDGEPERQRVFPMDAKPSLLTPPGSILISSPIKPNLLDLPQLQHRAAVIPPMVSCTPCNI\nPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEVLQ\nPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLSS\nHNQAYPQEAPKPSVGSISLGLPRQQESTKAAPLTYIKQEEFSPRSQNSQPEGLLVRAQHE\nGVVRGTAGAVQEGSITRGTPASKISVETISSLRGSITQGTPALPQAGIPTEALVKGPVSR\nMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEMSLKRSYEA\nVEGSIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATAESFE\nDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPE\nVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPENIKVVE\nRGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNT\nISRGSPMMNRTSDVSSSKSASHERKSTLTPTQRESIPAKSPVPGVDPIVSHSPFDPHHRS\nSAAGEVYRSHLPTHLDPAMPFHRALDPAAAYLLQRQLSPTPGYPSQYQLYAMENTRQTIL\nNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHAGGTSTPP\nMDRITYIPGTQVTFPPRPYNAASLSPGHPTHLAAAASAEREREREREKERERERERERER\nERERIAAAPADLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSVI\nTPLDPTAQLRIMPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKH\nEAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVCTSSALPSGKAQPHASVVYSEAG\nKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSH\nRYETASDAIEVISPASSPAPPQEKPQAYQPDMVKANQAENESTRQYEGPLHHYRSQQESP\nSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQASTSTFQTSPS\nALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEP\nYEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQRSDSRSPGSISYLPSFFTKLESTSPMVK\nSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDI\nIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAGVCKPKLI\nNKSNSRKSKSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNP\nLTIRMLSSTPPTQIACAPSAITQAAPHQQNRIWEREPAPLLSAQYETLSDSDD",
          "mw": 29.165,
          "total_mw": 29.165,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "Mediates transcriptional repression by certain nuclear receptors. Part of a complex which promotes histone deacetylation and the formation of repressive chromatin structures which may impede the access of basal transcription factors. Participates in the transcriptional repressor activity produced by BCL6. Recruited by ZBTB7A to the androgen response elements/ARE on target genes, negatively regulates androgen receptor signaling and androgen-induced cell proliferation (By similarity). Mediates the NR1D1-dependent repression and circadian regulation of TSHB expression (PubMed:24794873). The NCOR1-HDAC3 complex regulates the circadian expression of the core clock gene ARTNL/BMAL1 and the genes involved in lipid metabolism in the liver (PubMed:19037247)."
        }
      ],
      "buffer": {
        "name": "20 mM Tris HCl, 75 mM NaCl, 75 mM KCl, 2 mM CHAPS, 4 mM MgCl₂, 12 mM TCEP",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "RAR/RXR heterodimer : BMS493 : NCoR NID : IR0 element",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "Centre de Biologie Structurale (CBS), CNRS, INSERM, Univ Montpellier ",
            "webpage": null
          }
        ],
        "contributor_name": "Izabella",
        "contributor_surname": "Tambones",
        "orcid": "https://orcid.org/0000-0002-4073-9227"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2022-04-20",
    "storage_temperature": 15.0,
    "cell_temperature": 15.0,
    "exposure_time": 1.99,
    "number_of_frames": 990,
    "wavelength": 0.10332,
    "sample_detector_distance": 2.0,
    "concentration_min": null,
    "concentration_max": 10.0,
    "sample_volume": 50.0,
    "flow_rate": 0.2,
    "s_min": 0.105,
    "s_max": 5.592,
    "total_exposure_time": null,
    "seccolumn": 1
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": null,
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 186.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 160.0,
  "porod_mw_error": null,
  "pddf_i0": 0.01409,
  "pddf_i0_error": null,
  "guinier_i0": 0.0135049,
  "guinier_i0_error": null,
  "pddf_rg": 6.04,
  "pddf_rg_error": null,
  "guinier_rg": 5.5,
  "guinier_rg_error": 0.04,
  "pddf_dmax": 22.93,
  "pddf_dmax_error": null,
  "porod_volume": 257.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 20,
  "guinier_point_last": 31,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDXV2_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2025-10-13T13:31:56.857404+02:00",
  "bragg_peak": []
}