{
  "code": "SASDXV4",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "The role of kinase domain dimerization in EGFR activation",
    "publication": null,
    "status": "released",
    "submitted_date": "2025-03-16",
    "released_date": "2025-11-02"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDXV4.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXV4.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXV4_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXV4_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDXV4_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXV4_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXV4.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Rigaku HyPix - 3000",
        "name": "Rigaku PSAXS Nano",
        "resolution": 100.0
      },
      "name": "Yale University",
      "city": "New Haven",
      "country": "United States",
      "beamline_name": "Rigaku MicroMax-007HF",
      "beam_geometry": null,
      "type_of_source": "X-ray in house",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Receptor protein-tyrosine kinase (duplication mutant)",
          "short_name": "KDD",
          "sequence": "HHHHHHSSGVDLGTENLYFQSMGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLLVEPLTPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQQG",
          "organism": "Homo sapiens",
          "uniprot_code": "Q504U8",
          "uniprot_range_first": 651,
          "uniprot_range_last": 993,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV\nVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA\nVLSNYDANKTGLKELPMRNLQGQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRG\nKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKY\nSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEF\nKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFL\nLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISG\nNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVS\nCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHY\nIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPS\nIATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLR\nILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYV\nMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGM\nNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALES\nILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYM\nIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEE\nDMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSF\nLQRYSSDPTGALTEDSIDDTFLPVPGEWLVWKQSCSSTSSTHSAAASLQCPSQVLPPASP\nEGETVADLQTQ",
          "mw": 79.594,
          "total_mw": 79.594,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "EGFR kinase domain duplication mutant. The purified construct consists of amino acids 643-976 appended to amino acids 651-993 using mature protein numbering (UniProt Q504U8 numbering: 651-993 followed by a duplicated 643-977 region). The protein construct used for SAXS contains an additional N-terminal non-native 22 amino acid extension and polyhistidine tag (HHHHHHSSGVDLGTENLYFQSM)."
        }
      ],
      "buffer": {
        "name": "20 mM HEPES, 250 mM NaCl, 250 mM KCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "EGFR kinase domain duplication mutant (KDD) at 2.6 mg/ml",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "New Haven, CT, USA",
            "full_name": "Yale University",
            "webpage": "https://www.yale.edu/"
          }
        ],
        "contributor_name": "Zaritza",
        "contributor_surname": "Petrova",
        "orcid": "https://orcid.org/0000-0002-4877-4676"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2022-03-22",
    "storage_temperature": 4.0,
    "cell_temperature": 4.0,
    "exposure_time": 7200.0,
    "number_of_frames": 3,
    "wavelength": 0.1542,
    "sample_detector_distance": 0.491,
    "concentration_min": null,
    "concentration_max": 2.6,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.07,
    "s_max": 5.008,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "SAXS data from solutions of EGFR kinase domain duplication mutant in 20 mM HEPES, 250 mM NaCl, 250 mM KCl, pH 8 were collected on the Rigaku MicroMax-007HF instrument (Yale University, New Haven, United States) using a Rigaku PSAXS Nano detector at a sample-detector distance of 0.5 m and at a wavelength of λ = 0.1542 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 2.60 mg/ml was measured at 4°C. Three successive 7200 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 86.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": 86.0,
  "guinier_i0_mw_error": null,
  "porod_mw": 101.0,
  "porod_mw_error": null,
  "pddf_i0": 0.2736,
  "pddf_i0_error": null,
  "guinier_i0": 0.278134,
  "guinier_i0_error": null,
  "pddf_rg": 4.87,
  "pddf_rg_error": null,
  "guinier_rg": 4.867,
  "guinier_rg_error": 0.663,
  "pddf_dmax": 16.4,
  "pddf_dmax_error": null,
  "porod_volume": 163.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 2,
  "guinier_point_last": 25,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDXV4_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2025-11-02T21:11:43.418457+01:00",
  "bragg_peak": []
}