{
  "code": "SASDZV5",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "The Rho guanine-nucleotide exchange factor P-Rex2 exhibits structural and regulatory features distinct from the related RhoGEF P-Rex1",
    "publication": {
      "title": "The Rho guanine-nucleotide exchange factor P-Rex2 exhibits structural and regulatory features distinct from the related RhoGEF P-Rex1",
      "author_list": "Anderson L, Marde R, Muma G, Nayak V, Phan C, Li S, Cash J",
      "journal": "Journal of Biological Chemistry",
      "doi": "10.1016/j.jbc.2026.113229",
      "pmid": null,
      "published_date": "2026 Jul"
    },
    "status": "released",
    "submitted_date": "2026-04-03",
    "released_date": "2026-07-23"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDZV5.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDZV5.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZV5_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZV5_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDZV5_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDZV5_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDZV5.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus3 X 2M",
        "resolution": 172.0
      },
      "name": "Advanced Light Source (ALS)",
      "city": "Berkeley, CA",
      "country": "USA",
      "beamline_name": "12.3.1 (SIBYLS)",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 DH/PH tandem",
          "short_name": "P-Rex2 DH/PH tandem",
          "sequence": "GAMDPMSEDSRGDSRAESAKDLEKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAASKVDKNVTEETVKMLFSNIEDILAVHKEFLKVVEECLHPEPNAQQEVGTCFLHFKDKFRIYDEYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLILKELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNITDTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGHRYLFRGRINTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEWFEAILKERERRKGLKLGMEQDTWVM",
          "organism": "Homo sapiens",
          "uniprot_code": "Q70Z35",
          "uniprot_range_first": 1,
          "uniprot_range_last": 377,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSEDSRGDSRAESAKDLEKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAASK\nVDKNVTEETVKMLFSNIEDILAVHKEFLKVVEECLHPEPNAQQEVGTCFLHFKDKFRIYD\nEYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLIL\nKELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNIT\nDTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGHRYLFRGRI\nNTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEWFEAILKER\nERRKGLKLGMEQDTWVMISEQGEKLYKMMCRQGNLIKDRKRKLTTFPKCFLGSEFVSWLL\nEIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPRNEMQDVIS\nKGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLC\nDNGFMHHVLEKSEFKDEPLLFRFFSDEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNE\nGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCL\nNSRKPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCII\nKVNGINVSKETHASVIAHVTACRKYRRPTKQDSIQWVYNSIESAQEDLQKSHSKPPGDEA\nGDAFDCKVEEVIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYEYDSTAGIKCNVVEKMI\nEPKGFFSLTAKILEALAKSDEHFVQNCTSLNSLNEVIPTDLQSKFSALCSERIEHLCQRI\nSSYKKFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHVNVMEVSYPKTSTSLGSAFGV\nQLDSRKHNSHDKENKSSEQGKLSPMVYIQHTITTMAAPSGLSLGQQDGHGLRYLLKEEDL\nETQDIYQKLLGKLQTALKEVEMCVCQIDDLLSSITYSPKLERKTSEGIIPTDSDNEKGER\nNSKRVCFNVAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSQCSSYFHSDEMDS\nGDELPLSVRISHDKQDKIHSCLEHLFSQVDSITNLLKGQAVVRAFDQTKYLTPGRGLQEF\nQQEMEPKLSCPKRLRLHIKQDPWNLPSSVRTLAQNIRKFVEEVKCRLLLALLEYSDSETQ\nLRRDMVFCQTLVATVCAFSEQLMAALNQMFDNSKENEMETWEASRRWLDQIANAGVLFHF\nQSLLSPNLTDEQAMLEDTLVALFDLEKVSFYFKPSEEEPLVANVPLTYQAEGSRQALKVY\nFYIDSYHFEQLPQRLKNGGGFKIHPVLFAQALESMEGYYYRDNVSVEEFQAQINAASLEK\nVKQYNQKLRAFYLDKSNSPPNSTSKAAYVDKLMRPLNALDELYRLVASFIRSKRTAACAN\nTACSASGVGLLSVSSELCNRLGACHIIMCSSGVHRCTLSVTLEQAIILARSHGLPPRYIM\nQATDVMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCEPPPPAGEE",
          "mw": 44.366,
          "total_mw": 44.366,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "Isolated P-Rex2 DH/PH tandem with residual linker (GAMDP) from N-terminal TEV cleavage"
        }
      ],
      "buffer": {
        "name": "20 mM HEPES, 200 mM NaCl, 2 mM DTT, 1% glycerol",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Human Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger protein 2 DH/PH domain tandem (P-Rex2 DH/PH)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "University of California, Davis",
            "webpage": null
          }
        ],
        "contributor_name": "Lauren",
        "contributor_surname": "Anderson",
        "orcid": "http://lauanderson@ucdavis.edu"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2025-06-10",
    "storage_temperature": null,
    "cell_temperature": null,
    "exposure_time": 2.0,
    "number_of_frames": 750,
    "wavelength": 0.1127,
    "sample_detector_distance": 2.1,
    "concentration_min": null,
    "concentration_max": 2.0,
    "sample_volume": null,
    "flow_rate": 0.65,
    "s_min": 0.124,
    "s_max": 4.707,
    "total_exposure_time": null,
    "seccolumn": 17
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDZV5_fit1_model1_img.png",
          "software": "BILBOMD",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDZV5_fit1_model1.pdb",
          "model_mw": 43.75,
          "bead_radius": null,
          "log": null,
          "symmetry": null,
          "comment": null,
          "user": 1310
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDZV5_fit1_fitfoxs_img.png",
      "software": "MultiFoXS",
      "chi_square_value": 0.679376,
      "p_value": 0.0017,
      "fit_residual_plot": "SASDZV5_fit1_fitfoxsresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDZV5_fit1.dat",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/feedback.log",
      "software_version": null,
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": "Small-angle X-ray scattering (SAXS) experiments were performed at the SIBYLS beamline 12.3.1 at the Advanced Light Source. This beamline has additional inline instrumentation and detectors coupled to a size exclusion column. Purified P-Rex2 DH/PH was concentrated to 2 mg/ml and then buffer exchanged into 20mM HEPES (pH 7), 200mM NaCl, 2mM DTT, and 1% glycerol SEC running buffer. The X-ray wavelength was set to 1.127 Å and the sample-to-detector distance to 2,100 mm, which gives scattering vectors (q) ranging from 0.01 Å-1 to 0.4 Å-1. The scattering vector is q = 4πsinθ/λ, where 2θ is the scattering angle. The SAXS flow cell was coupled to an Agilent 1260 Infinity HPLC system using a Shodex PROTEIN KW-802.5 SEC column equilibrated with the running buffer with a flow rate of 0.65 ml/min. For SAXS measurements, 2 sec X-ray exposures were collected continuously during a 25 min elution. All frames for analyses had one SAXS frame corresponding to the running buffer before the detection of a peak subtracted from each.",
  "experiment_description": null,
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 41.6,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 43.4,
  "porod_mw_error": null,
  "pddf_i0": 9.84,
  "pddf_i0_error": 0.07,
  "guinier_i0": 9.67557,
  "guinier_i0_error": null,
  "pddf_rg": 2.694,
  "pddf_rg_error": 0.016,
  "guinier_rg": 2.612,
  "guinier_rg_error": 0.381,
  "pddf_dmax": 8.4,
  "pddf_dmax_error": null,
  "porod_volume": 52.3,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 11,
  "guinier_point_last": 76,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDZV5_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2026-07-23T20:42:10.836675+02:00",
  "bragg_peak": []
}