data_SASDDV8_MAIN # _sas_result.id 988 _sas_result.SASBDB_code SASDDV8 _sas_result.experimental_MW 43.000 _sas_result.experimental_MW_error . _sas_result.MW_standard . _sas_result.MW_standard_error . _sas_result.MW_Porod . _sas_result.MW_Porod_error . _sas_result.I0_from_PR . _sas_result.I0_from_PR_error . _sas_result.I0_from_Guinier . _sas_result.I0_from_Guinier_error . _sas_result.Rg_from_PR 4.000 _sas_result.Rg_from_PR_error . _sas_result.Rg_from_Guinier . _sas_result.Rg_from_Guinier_error . _sas_result.D_max . _sas_result.Porod_volume . _sas_result.Porod_volume_error . _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min . _sas_result.Guinier_point_max . _sas_result.type_of_curve merged _sas_result.standard . _sas_result.Dmax_error . _sas_result.comments . # _sas_scan.title "Boiled chicken egg albumen" _sas_scan.detc_id 62 _sas_scan.id 988 _sas_scan.measurement_date 2013-06-27 _sas_scan.storage_temperature 4.0 _sas_scan.cell_temperature 10.0 _sas_scan.exposure_time 1800.000 _sas_scan.number_of_frames 1 _sas_scan.unit 1/A _sas_scan.qmin 0.0080 _sas_scan.qmax 0.3280 _sas_scan.sample_id 948 _sas_scan.result_id 988 _sas_scan.beam_id 85 # _sas_beam.id 85 _sas_beam.instrument_name "University of Pennslyvania Bruker Nonius FR591" _sas_beam.instrument_city "Philadelphia, PA" _sas_beam.instrument_country "United States" _sas_beam.shape . _sas_beam.type_of_source "X-ray in house" _sas_beam.radiation_wavelength 0.154200 _sas_beam.dist_spec_to_detc 1.50000 # _sas_detc.id 62 _sas_detc.name "Bruker Hi-Star multiwire detector" _sas_detc.type . _sas_detc.pixsize_x . # _sas_sample.id 948 _sas_sample.name "Boiled chicken egg albumen" _sas_sample.ext_coefficient . _sas_sample.contrast . _sas_sample.specific_vol . _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration 170.00 _sas_sample.concentration_method . _sas_sample.entity_id 1155 # _sas_buffer.id 612 _sas_buffer.name Water _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.000 _sas_buffer.comment . _sas_buffer.composition . _sas_buffer.sample_id 948 # _entity.id 1155 _entity.type protein _entity.pdbx_description Ovalbumin _entity.formula_weight 42.750 _entity.pdbx_number_of_molecules 1 # _entity_name_com.entity_id 1155 _entity_name_com.name Ova # _entity_poly.entity_id 1155 _entity_poly.pdbx_seq_one_letter_code ;GSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRFDKLPGFGDSIEAQCGTSVNV HSSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYLQCVKELYRGGLEPINFQTAADQARELINSWVESQTNGIIRN VLQPSSVDSQTAMVLVNAIVFKGLWEKAFKDEDTQAMPFRVTEQESKPVQMMYQIGLFRVASMASEKMKILELPFASGTM SMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSVLMAMGITDVFSSSANLSGISSAE SLKISQAVHAAHAEINEAGREVVGSAEAGVDAASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP ; # _entity_src_gen.entity_id 1155 _entity_src_gen.gene_src_common_name "Gallus gallus" # _struct_ref.id 1 _struct_ref.entity_id 1155 _struct_ref.db_name UniProt _struct_ref.db_code P01012 _struct_ref.details http://www.uniprot.org/uniprot/P01012 # _citation.id 365 _citation.title "The Proof Is in the Pidan: Generalizing Proteins as Patchy Particles" _citation.year "2018 Jun 28" _citation.pdbx_database_id_DOI 10.1021/acscentsci.8b00187 _citation.pdbx_database_id_PubMed . # _citation_author.citation_id 365 _citation_author.ordinal 1 loop_ _citation_author.name "Cai J" "Sweeney A" # _pdbx_contact_author.id 162 _pdbx_contact_author.name_first Jing _pdbx_contact_author.name_last Cai _pdbx_contact_author.role . _pdbx_contact_author.address_1 Penn _pdbx_contact_author.address_2 "University of Pennsylvania" _pdbx_contact_author.address_3 "Philadelphia, PA, United States" # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 8.000000E-03 7.608400E+01 2.282520E+00 988 2 1.000000E-02 4.271700E+01 1.281510E+00 988 3 1.200000E-02 2.659900E+01 7.979700E-01 988 4 1.400000E-02 1.907500E+01 5.722500E-01 988 5 1.600000E-02 1.521200E+01 4.563600E-01 988 6 1.800000E-02 1.232900E+01 3.698700E-01 988 7 2.000000E-02 1.006700E+01 3.020100E-01 988 8 2.200000E-02 8.934000E+00 2.680200E-01 988 9 2.400000E-02 7.986400E+00 2.395920E-01 988 10 2.600000E-02 6.941900E+00 2.082570E-01 988 11 2.800000E-02 6.375800E+00 1.912740E-01 988 12 3.000000E-02 5.867200E+00 1.760160E-01 988 13 3.200000E-02 5.199800E+00 1.559940E-01 988 14 3.400000E-02 4.594200E+00 1.378260E-01 988 15 3.600000E-02 4.172800E+00 1.251840E-01 988 16 3.800000E-02 3.768500E+00 1.130550E-01 988 17 4.000000E-02 3.344800E+00 1.003440E-01 988 18 4.200000E-02 2.995300E+00 8.985900E-02 988 19 4.400000E-02 2.728300E+00 8.184900E-02 988 20 4.600000E-02 2.488200E+00 7.464600E-02 988 21 4.800000E-02 2.169800E+00 6.509400E-02 988 22 5.000000E-02 1.893000E+00 5.679000E-02 988 23 5.200000E-02 1.677100E+00 5.031300E-02 988 24 5.400000E-02 1.541500E+00 4.624500E-02 988 25 5.600000E-02 1.359700E+00 4.079100E-02 988 26 5.800000E-02 1.253100E+00 3.759300E-02 988 27 6.000000E-02 1.061300E+00 3.183900E-02 988 28 6.200000E-02 9.620100E-01 2.886030E-02 988 29 6.400000E-02 8.640300E-01 2.592090E-02 988 30 6.600000E-02 7.496000E-01 2.248800E-02 988 31 6.800000E-02 6.791100E-01 2.037330E-02 988 32 7.000000E-02 6.181200E-01 1.854360E-02 988 33 7.200000E-02 5.616000E-01 1.684800E-02 988 34 7.400000E-02 4.965600E-01 1.489680E-02 988 35 7.600000E-02 4.543300E-01 1.362990E-02 988 36 7.800000E-02 4.236700E-01 1.271010E-02 988 37 8.000000E-02 4.150900E-01 1.245270E-02 988 38 8.200000E-02 3.890500E-01 1.167150E-02 988 39 8.400000E-02 3.476500E-01 1.042950E-02 988 40 8.600000E-02 3.253300E-01 9.759900E-03 988 41 8.800000E-02 3.130000E-01 9.390000E-03 988 42 9.000000E-02 2.800200E-01 8.400600E-03 988 43 9.200000E-02 2.669600E-01 8.008800E-03 988 44 9.400000E-02 2.447000E-01 7.341000E-03 988 45 9.600000E-02 2.238400E-01 6.715200E-03 988 46 9.800000E-02 2.079000E-01 6.237000E-03 988 47 1.000000E-01 2.043000E-01 6.129000E-03 988 48 1.020000E-01 1.867800E-01 5.603400E-03 988 49 1.040000E-01 1.917600E-01 5.752800E-03 988 50 1.060000E-01 1.714400E-01 5.143200E-03 988 51 1.080000E-01 1.624700E-01 4.874100E-03 988 52 1.100000E-01 1.594800E-01 4.784400E-03 988 53 1.120000E-01 1.591100E-01 4.773300E-03 988 54 1.140000E-01 1.432100E-01 4.296300E-03 988 55 1.160000E-01 1.407600E-01 4.222800E-03 988 56 1.180000E-01 1.393400E-01 4.180200E-03 988 57 1.200000E-01 1.340300E-01 4.020900E-03 988 58 1.220000E-01 1.233000E-01 3.699000E-03 988 59 1.240000E-01 1.236500E-01 3.709500E-03 988 60 1.260000E-01 1.132500E-01 3.397500E-03 988 61 1.280000E-01 1.177700E-01 3.533100E-03 988 62 1.300000E-01 1.106100E-01 3.318300E-03 988 63 1.320000E-01 1.049800E-01 3.149400E-03 988 64 1.340000E-01 1.052400E-01 3.157200E-03 988 65 1.360000E-01 1.088400E-01 3.265200E-03 988 66 1.380000E-01 9.553300E-02 2.865990E-03 988 67 1.400000E-01 9.097200E-02 2.729160E-03 988 68 1.420000E-01 9.128700E-02 2.738610E-03 988 69 1.440000E-01 9.183800E-02 2.755140E-03 988 70 1.460000E-01 8.519200E-02 2.555760E-03 988 71 1.480000E-01 9.064500E-02 2.719350E-03 988 72 1.500000E-01 8.226400E-02 2.467920E-03 988 73 1.520000E-01 8.754100E-02 2.626230E-03 988 74 1.540000E-01 8.576500E-02 2.572950E-03 988 75 1.560000E-01 7.977100E-02 2.393130E-03 988 76 1.580000E-01 7.773200E-02 2.331960E-03 988 77 1.600000E-01 7.518100E-02 2.255430E-03 988 78 1.620000E-01 7.706800E-02 2.312040E-03 988 79 1.640000E-01 7.178800E-02 2.153640E-03 988 80 1.660000E-01 7.401300E-02 2.220390E-03 988 81 1.680000E-01 6.940400E-02 2.082120E-03 988 82 1.700000E-01 6.951100E-02 2.085330E-03 988 83 1.720000E-01 7.615700E-02 2.284710E-03 988 84 1.740000E-01 7.167600E-02 2.150280E-03 988 85 1.760000E-01 7.101900E-02 2.130570E-03 988 86 1.780000E-01 6.901500E-02 2.070450E-03 988 87 1.800000E-01 6.481000E-02 1.944300E-03 988 88 1.820000E-01 6.311800E-02 1.893540E-03 988 89 1.840000E-01 6.396500E-02 1.918950E-03 988 90 1.860000E-01 6.673000E-02 2.001900E-03 988 91 1.880000E-01 6.406700E-02 1.922010E-03 988 92 1.900000E-01 6.333000E-02 1.899900E-03 988 93 1.920000E-01 6.463500E-02 1.939050E-03 988 94 1.940000E-01 6.369900E-02 1.910970E-03 988 95 1.960000E-01 6.171800E-02 1.851540E-03 988 96 1.980000E-01 6.204400E-02 1.861320E-03 988 97 2.000000E-01 6.107700E-02 1.832310E-03 988 98 2.020000E-01 6.056300E-02 1.816890E-03 988 99 2.040000E-01 5.877900E-02 1.763370E-03 988 100 2.060000E-01 5.984700E-02 1.795410E-03 988 101 2.080000E-01 5.971900E-02 1.791570E-03 988 102 2.100000E-01 6.543500E-02 1.963050E-03 988 103 2.120000E-01 6.472600E-02 1.941780E-03 988 104 2.140000E-01 5.432600E-02 1.629780E-03 988 105 2.160000E-01 5.756900E-02 1.727070E-03 988 106 2.180000E-01 5.971700E-02 1.791510E-03 988 107 2.200000E-01 5.582700E-02 1.674810E-03 988 108 2.220000E-01 5.825900E-02 1.747770E-03 988 109 2.240000E-01 5.851600E-02 1.755480E-03 988 110 2.260000E-01 5.736900E-02 1.721070E-03 988 111 2.280000E-01 5.773800E-02 1.732140E-03 988 112 2.300000E-01 5.573300E-02 1.671990E-03 988 113 2.320000E-01 5.698700E-02 1.709610E-03 988 114 2.340000E-01 5.389400E-02 1.616820E-03 988 115 2.360000E-01 5.481800E-02 1.644540E-03 988 116 2.380000E-01 5.313000E-02 1.593900E-03 988 117 2.400000E-01 5.400200E-02 1.620060E-03 988 118 2.420000E-01 5.548600E-02 1.664580E-03 988 119 2.440000E-01 5.149600E-02 1.544880E-03 988 120 2.460000E-01 5.129900E-02 1.538970E-03 988 121 2.480000E-01 5.264700E-02 1.579410E-03 988 122 2.500000E-01 5.630900E-02 1.689270E-03 988 123 2.520000E-01 5.283500E-02 1.585050E-03 988 124 2.540000E-01 5.130600E-02 1.539180E-03 988 125 2.560000E-01 5.150400E-02 1.545120E-03 988 126 2.580000E-01 5.279000E-02 1.583700E-03 988 127 2.600000E-01 5.168400E-02 1.550520E-03 988 128 2.620000E-01 5.051000E-02 1.515300E-03 988 129 2.640000E-01 5.070500E-02 1.521150E-03 988 130 2.660000E-01 5.056800E-02 1.517040E-03 988 131 2.680000E-01 5.228500E-02 1.568550E-03 988 132 2.700000E-01 4.958700E-02 1.487610E-03 988 133 2.720000E-01 4.978500E-02 1.493550E-03 988 134 2.740000E-01 5.043200E-02 1.512960E-03 988 135 2.760000E-01 4.967000E-02 1.490100E-03 988 136 2.780000E-01 4.898600E-02 1.469580E-03 988 137 2.800000E-01 5.204500E-02 1.561350E-03 988 138 2.820000E-01 4.896100E-02 1.468830E-03 988 139 2.840000E-01 4.799900E-02 1.439970E-03 988 140 2.860000E-01 5.317100E-02 1.595130E-03 988 141 2.880000E-01 5.028200E-02 1.508460E-03 988 142 2.900000E-01 5.043100E-02 1.512930E-03 988 143 2.920000E-01 4.961800E-02 1.488540E-03 988 144 2.940000E-01 4.729400E-02 1.418820E-03 988 145 2.960000E-01 4.655700E-02 1.396710E-03 988 146 2.980000E-01 5.040100E-02 1.512030E-03 988 147 3.000000E-01 4.835400E-02 1.450620E-03 988 148 3.020000E-01 5.101200E-02 1.530360E-03 988 149 3.040000E-01 4.712400E-02 1.413720E-03 988 150 3.060000E-01 4.730900E-02 1.419270E-03 988 151 3.080000E-01 4.883400E-02 1.465020E-03 988 152 3.100000E-01 4.394800E-02 1.318440E-03 988 153 3.120000E-01 4.519200E-02 1.355760E-03 988 154 3.140000E-01 4.867800E-02 1.460340E-03 988 155 3.160000E-01 4.542000E-02 1.362600E-03 988 156 3.180000E-01 4.677700E-02 1.403310E-03 988 157 3.200000E-01 4.578700E-02 1.373610E-03 988 158 3.220000E-01 4.743600E-02 1.423080E-03 988 159 3.240000E-01 4.928200E-02 1.478460E-03 988 160 3.260000E-01 4.661300E-02 1.398390E-03 988 161 3.280000E-01 4.676700E-02 1.403010E-03 988 #