data_SASDDW8_MAIN # _sas_result.id 989 _sas_result.SASBDB_code SASDDW8 _sas_result.experimental_MW 42.000 _sas_result.experimental_MW_error . _sas_result.MW_standard . _sas_result.MW_standard_error . _sas_result.MW_Porod . _sas_result.MW_Porod_error . _sas_result.I0_from_PR . _sas_result.I0_from_PR_error . _sas_result.I0_from_Guinier 1.0000000000 _sas_result.I0_from_Guinier_error . _sas_result.Rg_from_PR . _sas_result.Rg_from_PR_error . _sas_result.Rg_from_Guinier . _sas_result.Rg_from_Guinier_error . _sas_result.D_max . _sas_result.Porod_volume . _sas_result.Porod_volume_error . _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min . _sas_result.Guinier_point_max . _sas_result.type_of_curve single_conc _sas_result.standard . _sas_result.Dmax_error . _sas_result.comments . # _sas_scan.title "Chinese century egg albumen (pidan) made from quail egg" _sas_scan.detc_id 62 _sas_scan.id 989 _sas_scan.measurement_date 2013-06-27 _sas_scan.storage_temperature 4.0 _sas_scan.cell_temperature 10.0 _sas_scan.exposure_time 1800.000 _sas_scan.number_of_frames 1 _sas_scan.unit 1/A _sas_scan.qmin 0.0080 _sas_scan.qmax 0.3280 _sas_scan.sample_id 949 _sas_scan.result_id 989 _sas_scan.beam_id 85 # _sas_beam.id 85 _sas_beam.instrument_name "University of Pennslyvania Bruker Nonius FR591" _sas_beam.instrument_city "Philadelphia, PA" _sas_beam.instrument_country "United States" _sas_beam.shape . _sas_beam.type_of_source "X-ray in house" _sas_beam.radiation_wavelength 0.154200 _sas_beam.dist_spec_to_detc 1.50000 # _sas_detc.id 62 _sas_detc.name "Bruker Hi-Star multiwire detector" _sas_detc.type . _sas_detc.pixsize_x . # _sas_sample.id 949 _sas_sample.name "Chinese century egg albumen (pidan) made from quail egg" _sas_sample.ext_coefficient . _sas_sample.contrast . _sas_sample.specific_vol . _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration 170.00 _sas_sample.concentration_method . _sas_sample.entity_id 1157 # _sas_buffer.id 612 _sas_buffer.name Water _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.000 _sas_buffer.comment . _sas_buffer.composition . _sas_buffer.sample_id 949 # _entity.id 1157 _entity.type protein _entity.pdbx_description "Ovalbumin (common quail)" _entity.formula_weight 42.078 _entity.pdbx_number_of_molecules 1 # _entity_name_com.entity_id 1157 _entity_name_com.name Ova # _entity_poly.entity_id 1157 _entity_poly.pdbx_seq_one_letter_code ;GSIGAASMEFCFDVFKELKVHHANDNMLYSPFAILSTLAMVFLGAKDSTRTQINKVVHFDKLPGFGDSI EAQCGTSANVHSSLRDILNQITKQNDAYSFSLASRLYAQETYTVVPEYLQCVKELYRGGLESVNFQTAAD QARGLINAWVESQTNGIIRNILQPSSVDSQTAMVLVNAIAFKGLWEKAFKAEDTQTIPFRVTEQESKPVQ MMHQIGSFKVASMASEKMKILELPFASGTMSMLVLLPDDVSGLEQLESTISFEKLTEWTSSSIMEERKVK VYLPRMKMEEKYNLTSLLMAMGITDLFSSSANLSGISSVGSLKIPQAVHAAYAEINEAGRDVVGSAEAGV DATEEFRADHPFLFCVKHIETNAILLFGRCVSP ; # _entity_src_gen.entity_id 1157 _entity_src_gen.gene_src_common_name "Coturnix coturnix" # _struct_ref.id 1 _struct_ref.entity_id 1157 _struct_ref.db_name UniProt _struct_ref.db_code Q6V115 _struct_ref.details http://www.uniprot.org/uniprot/Q6V115 # _citation.id 365 _citation.title "The Proof Is in the Pidan: Generalizing Proteins as Patchy Particles" _citation.year "2018 Jun 28" _citation.pdbx_database_id_DOI 10.1021/acscentsci.8b00187 _citation.pdbx_database_id_PubMed . # _citation_author.citation_id 365 _citation_author.ordinal 1 loop_ _citation_author.name "Cai J" "Sweeney A" # _pdbx_contact_author.id 162 _pdbx_contact_author.name_first Jing _pdbx_contact_author.name_last Cai _pdbx_contact_author.role . _pdbx_contact_author.address_1 Penn _pdbx_contact_author.address_2 "University of Pennsylvania" _pdbx_contact_author.address_3 "Philadelphia, PA, United States" # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 8.000000E-03 6.804800E-01 2.436020E-02 989 2 1.000000E-02 5.636100E-01 2.066550E-02 989 3 1.200000E-02 4.813600E-01 1.751850E-02 989 4 1.400000E-02 4.362100E-01 1.487720E-02 989 5 1.600000E-02 3.736500E-01 1.270010E-02 989 6 1.800000E-02 3.754700E-01 1.094540E-02 989 7 2.000000E-02 3.311100E-01 9.571400E-03 989 8 2.200000E-02 3.259900E-01 8.536360E-03 989 9 2.400000E-02 3.133600E-01 7.798570E-03 989 10 2.600000E-02 2.980000E-01 7.316320E-03 989 11 2.800000E-02 2.975200E-01 7.047890E-03 989 12 3.000000E-02 2.976100E-01 6.951550E-03 989 13 3.200000E-02 2.826600E-01 6.985590E-03 989 14 3.400000E-02 2.710800E-01 7.990280E-03 989 15 3.600000E-02 2.675100E-01 7.384710E-03 989 16 3.800000E-02 2.461500E-01 6.954700E-03 989 17 4.000000E-02 2.380600E-01 6.188630E-03 989 18 4.200000E-02 2.460700E-01 7.038000E-03 989 19 4.400000E-02 2.385600E-01 6.567860E-03 989 20 4.600000E-02 2.395600E-01 6.701560E-03 989 21 4.800000E-02 2.390000E-01 5.967500E-03 989 22 5.000000E-02 2.161200E-01 5.328320E-03 989 23 5.200000E-02 2.155800E-01 4.379090E-03 989 24 5.400000E-02 2.149100E-01 3.757530E-03 989 25 5.600000E-02 2.092600E-01 3.858100E-03 989 26 5.800000E-02 2.014400E-01 3.907340E-03 989 27 6.000000E-02 1.897800E-01 3.554030E-03 989 28 6.200000E-02 1.780600E-01 3.607580E-03 989 29 6.400000E-02 1.797600E-01 3.755640E-03 989 30 6.600000E-02 1.635700E-01 4.254360E-03 989 31 6.800000E-02 1.593800E-01 4.092820E-03 989 32 7.000000E-02 1.578800E-01 3.828520E-03 989 33 7.200000E-02 1.427900E-01 3.640090E-03 989 34 7.400000E-02 1.372400E-01 3.812910E-03 989 35 7.600000E-02 1.305400E-01 3.856250E-03 989 36 7.800000E-02 1.200100E-01 3.514350E-03 989 37 8.000000E-02 1.266200E-01 3.207770E-03 989 38 8.200000E-02 1.175800E-01 3.038730E-03 989 39 8.400000E-02 1.140900E-01 3.058760E-03 989 40 8.600000E-02 1.010300E-01 2.714200E-03 989 41 8.800000E-02 9.494700E-02 2.485320E-03 989 42 9.000000E-02 9.089200E-02 2.411520E-03 989 43 9.200000E-02 8.749200E-02 2.261300E-03 989 44 9.400000E-02 8.265700E-02 1.953630E-03 989 45 9.600000E-02 7.773900E-02 1.755070E-03 989 46 9.800000E-02 7.372900E-02 1.582610E-03 989 47 1.000000E-01 7.173200E-02 1.303030E-03 989 48 1.020000E-01 6.789500E-02 9.681860E-04 989 49 1.040000E-01 6.822600E-02 9.119140E-04 989 50 1.060000E-01 5.784700E-02 1.016980E-03 989 51 1.080000E-01 5.909800E-02 9.780390E-04 989 52 1.100000E-01 5.550700E-02 1.231560E-03 989 53 1.120000E-01 5.602900E-02 1.206740E-03 989 54 1.140000E-01 5.165700E-02 1.261340E-03 989 55 1.160000E-01 5.093700E-02 1.309920E-03 989 56 1.180000E-01 4.710600E-02 1.213770E-03 989 57 1.200000E-01 4.437700E-02 1.113090E-03 989 58 1.220000E-01 4.482700E-02 1.094800E-03 989 59 1.240000E-01 4.203500E-02 1.035180E-03 989 60 1.260000E-01 4.240300E-02 9.141000E-04 989 61 1.280000E-01 3.888000E-02 6.979950E-04 989 62 1.300000E-01 3.798800E-02 7.788030E-04 989 63 1.320000E-01 3.935200E-02 8.990350E-04 989 64 1.340000E-01 3.724000E-02 8.657040E-04 989 65 1.360000E-01 3.483000E-02 8.360930E-04 989 66 1.380000E-01 3.423300E-02 8.894660E-04 989 67 1.400000E-01 3.447400E-02 8.038650E-04 989 68 1.420000E-01 3.261000E-02 7.678160E-04 989 69 1.440000E-01 3.391700E-02 6.844220E-04 989 70 1.460000E-01 3.213600E-02 6.584430E-04 989 71 1.480000E-01 3.210100E-02 6.186720E-04 989 72 1.500000E-01 3.148100E-02 5.392650E-04 989 73 1.520000E-01 3.177400E-02 5.037760E-04 989 74 1.540000E-01 2.937100E-02 4.936870E-04 989 75 1.560000E-01 2.848300E-02 4.587070E-04 989 76 1.580000E-01 2.886400E-02 5.146910E-04 989 77 1.600000E-01 2.816500E-02 5.036200E-04 989 78 1.620000E-01 2.802200E-02 5.164620E-04 989 79 1.640000E-01 2.723300E-02 4.997190E-04 989 80 1.660000E-01 2.663100E-02 4.700810E-04 989 81 1.680000E-01 2.612500E-02 4.994670E-04 989 82 1.700000E-01 2.564700E-02 5.091670E-04 989 83 1.720000E-01 2.592700E-02 4.776020E-04 989 84 1.740000E-01 2.673200E-02 4.628710E-04 989 85 1.760000E-01 2.638100E-02 4.604680E-04 989 86 1.780000E-01 2.585300E-02 5.325810E-04 989 87 1.800000E-01 2.585400E-02 5.261150E-04 989 88 1.820000E-01 2.508800E-02 4.923280E-04 989 89 1.840000E-01 2.448800E-02 4.859070E-04 989 90 1.860000E-01 2.479800E-02 4.555160E-04 989 91 1.880000E-01 2.334300E-02 4.583020E-04 989 92 1.900000E-01 2.355500E-02 4.403320E-04 989 93 1.920000E-01 2.358600E-02 4.236990E-04 989 94 1.940000E-01 2.282100E-02 4.107930E-04 989 95 1.960000E-01 2.361600E-02 4.171360E-04 989 96 1.980000E-01 2.353500E-02 3.931930E-04 989 97 2.000000E-01 2.314100E-02 3.992290E-04 989 98 2.020000E-01 2.270500E-02 4.114020E-04 989 99 2.040000E-01 2.229500E-02 4.496280E-04 989 100 2.060000E-01 2.115800E-02 4.829100E-04 989 101 2.080000E-01 2.280600E-02 4.851570E-04 989 102 2.100000E-01 2.302200E-02 4.852320E-04 989 103 2.120000E-01 2.214300E-02 4.447840E-04 989 104 2.140000E-01 2.228300E-02 4.833470E-04 989 105 2.160000E-01 2.144700E-02 4.569020E-04 989 106 2.180000E-01 2.226700E-02 4.422110E-04 989 107 2.200000E-01 2.207900E-02 4.370910E-04 989 108 2.220000E-01 2.092700E-02 4.487020E-04 989 109 2.240000E-01 2.056700E-02 4.516960E-04 989 110 2.260000E-01 2.176300E-02 4.201890E-04 989 111 2.280000E-01 2.091600E-02 3.840970E-04 989 112 2.300000E-01 2.042400E-02 3.593120E-04 989 113 2.320000E-01 2.078500E-02 4.186710E-04 989 114 2.340000E-01 2.033700E-02 4.235590E-04 989 115 2.360000E-01 1.935900E-02 4.429420E-04 989 116 2.380000E-01 2.012900E-02 3.828060E-04 989 117 2.400000E-01 2.064500E-02 3.507840E-04 989 118 2.420000E-01 1.997300E-02 3.584090E-04 989 119 2.440000E-01 1.887500E-02 3.369200E-04 989 120 2.460000E-01 1.947900E-02 3.410120E-04 989 121 2.480000E-01 1.889900E-02 3.614230E-04 989 122 2.500000E-01 1.969900E-02 3.950270E-04 989 123 2.520000E-01 1.931400E-02 4.314590E-04 989 124 2.540000E-01 1.843500E-02 4.341150E-04 989 125 2.560000E-01 1.863400E-02 4.428800E-04 989 126 2.580000E-01 1.848600E-02 4.050860E-04 989 127 2.600000E-01 1.871400E-02 3.846680E-04 989 128 2.620000E-01 1.757000E-02 3.736050E-04 989 129 2.640000E-01 1.760400E-02 3.471520E-04 989 130 2.660000E-01 1.803800E-02 3.551530E-04 989 131 2.680000E-01 1.890500E-02 3.199450E-04 989 132 2.700000E-01 1.848600E-02 3.390520E-04 989 133 2.720000E-01 1.809000E-02 3.370720E-04 989 134 2.740000E-01 1.796600E-02 3.494640E-04 989 135 2.760000E-01 1.794000E-02 3.859130E-04 989 136 2.780000E-01 1.766500E-02 4.006060E-04 989 137 2.800000E-01 1.756600E-02 4.419470E-04 989 138 2.820000E-01 1.684000E-02 4.234870E-04 989 139 2.840000E-01 1.747800E-02 4.263660E-04 989 140 2.860000E-01 1.652400E-02 4.421920E-04 989 141 2.880000E-01 1.678600E-02 5.070510E-04 989 142 2.900000E-01 1.647200E-02 5.463900E-04 989 143 2.920000E-01 1.796200E-02 5.659240E-04 989 144 2.940000E-01 1.751400E-02 6.046860E-04 989 145 2.960000E-01 1.732500E-02 6.307780E-04 989 146 2.980000E-01 1.607700E-02 6.056230E-04 989 147 3.000000E-01 1.708500E-02 6.296100E-04 989 148 3.020000E-01 1.725000E-02 6.435970E-04 989 149 3.040000E-01 1.609200E-02 6.023090E-04 989 150 3.060000E-01 1.535800E-02 5.618140E-04 989 151 3.080000E-01 1.560900E-02 5.186990E-04 989 152 3.100000E-01 1.579100E-02 4.749510E-04 989 153 3.120000E-01 1.625200E-02 4.325580E-04 989 154 3.140000E-01 1.648100E-02 3.935080E-04 989 155 3.160000E-01 1.587900E-02 3.597870E-04 989 156 3.180000E-01 1.633200E-02 3.333830E-04 989 157 3.200000E-01 1.551400E-02 3.162840E-04 989 158 3.220000E-01 1.683800E-02 3.104770E-04 989 159 3.240000E-01 1.589500E-02 3.179490E-04 989 160 3.260000E-01 1.582900E-02 3.406880E-04 989 161 3.280000E-01 1.532900E-02 3.806820E-04 989 #