data_SASDCX4_MAIN # _sas_result.id 606 _sas_result.SASBDB_code SASDCX4 _sas_result.experimental_MW 119.140 _sas_result.experimental_MW_error . _sas_result.MW_standard 119.140 _sas_result.MW_standard_error . _sas_result.MW_Porod . _sas_result.MW_Porod_error . _sas_result.I0_from_PR 0.1400000000 _sas_result.I0_from_PR_error . _sas_result.I0_from_Guinier 0.1500000000 _sas_result.I0_from_Guinier_error 0.0002000000 _sas_result.Rg_from_PR 3.800 _sas_result.Rg_from_PR_error . _sas_result.Rg_from_Guinier 3.990 _sas_result.Rg_from_Guinier_error 0.040 _sas_result.D_max 11.50 _sas_result.Porod_volume 161.00 _sas_result.Porod_volume_error . _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min 14 _sas_result.Guinier_point_max 38 _sas_result.type_of_curve single_conc _sas_result.standard . _sas_result.Dmax_error . _sas_result.comments "BATCH mode" # _sas_scan.title "Bovine β Cardiac Myosin S1 fragment (Myosin-7) MgADP+OM" _sas_scan.detc_id 9 _sas_scan.id 606 _sas_scan.measurement_date 2016-03-01 _sas_scan.storage_temperature 4.0 _sas_scan.cell_temperature . _sas_scan.exposure_time 0.500 _sas_scan.number_of_frames 40 _sas_scan.unit 1/A _sas_scan.qmin 0.0199 _sas_scan.qmax 0.3060 _sas_scan.sample_id 564 _sas_scan.result_id 606 _sas_scan.beam_id 14 # _sas_beam.id 14 _sas_beam.instrument_name "SOLEIL SWING" _sas_beam.instrument_city Saint-Aubin _sas_beam.instrument_country France _sas_beam.shape . _sas_beam.type_of_source "X-ray synchrotron" _sas_beam.radiation_wavelength 0.103320 _sas_beam.dist_spec_to_detc 1.78600 # _sas_detc.id 9 _sas_detc.name AVIEX _sas_detc.type CCD _sas_detc.pixsize_x . # _sas_sample.id 564 _sas_sample.name "Bovine β Cardiac Myosin S1 fragment (Myosin-7) MgADP+OM" _sas_sample.ext_coefficient . _sas_sample.contrast . _sas_sample.specific_vol . _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration 4.00 _sas_sample.concentration_method . _sas_sample.entity_id 621 # _sas_buffer.id 307 _sas_buffer.name "10 mM HEPES, 50 mM NaCl, 1 mM NaN3, 2.5 mM MgCl2, 2 mM ADP, 1 mM TCEP" _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.500 _sas_buffer.comment . _sas_buffer.composition . _sas_buffer.sample_id 564 # _entity.id 621 _entity.type protein _entity.pdbx_description "Bovine β Cardiac Myosin S1 fragment" _entity.formula_weight 116.582 _entity.pdbx_number_of_molecules 1 # _entity_name_com.entity_id 621 _entity_name_com.name "BCS1 (myosin-7)" # _entity_poly.entity_id 621 _entity_poly.pdbx_seq_one_letter_code ;MVDAEMAAFGEAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKEEFVKATILSREGGKVT AETEHGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGL FCVTINPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES GAGKTVNTKRVIQYFAVIAAIGDRSKKEQATGKGTLEDQIIQANPALEAFGNAKTVRNDN SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM LLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTTEEKNSMYKLTGAIMHFG NMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV VYAKGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF TNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMF PKATDMTFKAKLFDNHLGKSSNFQKPRNIKGKPEAHFSLIHYAGTVDYNIIGWLQKNKDP LNETVVDLYKKSSLKMLSSLFANYAGFDTPIEKGKGKAKKGSSFQTVSALHRENLNKLMT NLRSTHPHFVRCIIPNETKSPGVIDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ RYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER LSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWP MAPKKPDPKKDEAKAGAKAAAAPAPAPAPPPAPEPSKEPEFDPSKIKIEFTPEQIEEFKE AFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFDTFLP MLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKLTEDEVEKLMAGQ EDSNGCINYEAFVKHIMAG ; # _entity_src_gen.entity_id 621 _entity_src_gen.gene_src_common_name "Bos taurus" # _struct_ref.id 1 _struct_ref.entity_id 621 _struct_ref.db_name UniProt _struct_ref.db_code Q9BE39 _struct_ref.details http://www.uniprot.org/uniprot/Q9BE39 # _citation.id 312 _citation.title "Mechanistic and structural basis for activation of cardiac myosin force production by omecamtiv mecarbil" _citation.year "2017 Dec" _citation.pdbx_database_id_DOI 10.1038/s41467-017-00176-5 _citation.pdbx_database_id_PubMed . # loop_ _citation_author.citation_id _citation_author.ordinal _citation_author.name 312 1 "Planelles-Herrero V" 312 2 "Hartman J" 312 3 "Robert-Paganin J" 312 4 "Malik F" # _pdbx_contact_author.id 153 _pdbx_contact_author.name_first "Vicente José" _pdbx_contact_author.name_last "Planelles Herrero" _pdbx_contact_author.role . _pdbx_contact_author.address_1 . _pdbx_contact_author.address_2 "Institut Curie" _pdbx_contact_author.address_3 . # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 1.990000E-02 1.310000E-01 1.870000E-04 606 2 2.040000E-02 1.301650E-01 1.830000E-04 606 3 2.100000E-02 1.274135E-01 1.810000E-04 606 4 2.160000E-02 1.248138E-01 1.760000E-04 606 5 2.210000E-02 1.230000E-01 1.740000E-04 606 6 2.270000E-02 1.206793E-01 1.710000E-04 606 7 2.330000E-02 1.185003E-01 1.680000E-04 606 8 2.390000E-02 1.150000E-01 1.660000E-04 606 9 2.440000E-02 1.140398E-01 1.620000E-04 606 10 2.500000E-02 1.116303E-01 1.600000E-04 606 11 2.560000E-02 1.093134E-01 1.570000E-04 606 12 2.610000E-02 1.080000E-01 1.550000E-04 606 13 2.670000E-02 1.052311E-01 1.530000E-04 606 14 2.730000E-02 1.036000E-01 1.500000E-04 606 15 2.780000E-02 1.010000E-01 1.490000E-04 606 16 2.840000E-02 9.999490E-02 1.460000E-04 606 17 2.900000E-02 9.711135E-02 1.440000E-04 606 18 2.950000E-02 9.500016E-02 1.420000E-04 606 19 3.010000E-02 9.380000E-02 1.400000E-04 606 20 3.070000E-02 9.166610E-02 1.390000E-04 606 21 3.120000E-02 8.974310E-02 1.360000E-04 606 22 3.180000E-02 8.730000E-02 1.350000E-04 606 23 3.240000E-02 8.600130E-02 1.320000E-04 606 24 3.290000E-02 8.443120E-02 1.310000E-04 606 25 3.350000E-02 8.321312E-02 1.290000E-04 606 26 3.410000E-02 8.130000E-02 1.270000E-04 606 27 3.460000E-02 7.943122E-02 1.260000E-04 606 28 3.520000E-02 7.731124E-02 1.240000E-04 606 29 3.580000E-02 7.530000E-02 1.230000E-04 606 30 3.630000E-02 7.471320E-02 1.210000E-04 606 31 3.690000E-02 7.331124E-02 1.190000E-04 606 32 3.750000E-02 7.173123E-02 1.190000E-04 606 33 3.810000E-02 7.020000E-02 1.170000E-04 606 34 3.860000E-02 6.874321E-02 1.150000E-04 606 35 3.920000E-02 6.731155E-02 1.140000E-04 606 36 3.980000E-02 6.590000E-02 1.130000E-04 606 37 4.030000E-02 6.411540E-02 1.120000E-04 606 38 4.090000E-02 6.301388E-02 1.100000E-04 606 39 4.150000E-02 6.166687E-02 1.090000E-04 606 40 4.200000E-02 6.110000E-02 1.080000E-04 606 41 4.260000E-02 5.861354E-02 1.070000E-04 606 42 4.320000E-02 5.761133E-02 1.050000E-04 606 43 4.370000E-02 5.697987E-02 1.040000E-04 606 44 4.430000E-02 5.600000E-02 1.030000E-04 606 45 4.490000E-02 5.394659E-02 1.020000E-04 606 46 4.540000E-02 5.331200E-02 1.020000E-04 606 47 4.600000E-02 5.250000E-02 1.040000E-04 606 48 4.660000E-02 5.076540E-02 1.040000E-04 606 49 4.710000E-02 4.983500E-02 1.030000E-04 606 50 4.770000E-02 4.900000E-02 1.030000E-04 606 51 4.830000E-02 4.780000E-02 1.020000E-04 606 52 4.880000E-02 4.720000E-02 1.010000E-04 606 53 4.940000E-02 4.600000E-02 1.030000E-04 606 54 5.000000E-02 4.440000E-02 1.020000E-04 606 55 5.050000E-02 4.430000E-02 1.010000E-04 606 56 5.110000E-02 4.310000E-02 9.890000E-05 606 57 5.170000E-02 4.210000E-02 9.890000E-05 606 58 5.220000E-02 4.120000E-02 9.870000E-05 606 59 5.280000E-02 4.000000E-02 9.760000E-05 606 60 5.340000E-02 3.880000E-02 9.680000E-05 606 61 5.400000E-02 3.780000E-02 9.630000E-05 606 62 5.450000E-02 3.710000E-02 9.610000E-05 606 63 5.510000E-02 3.640000E-02 9.500000E-05 606 64 5.570000E-02 3.560000E-02 9.510000E-05 606 65 5.620000E-02 3.480000E-02 9.500000E-05 606 66 5.680000E-02 3.400000E-02 9.420000E-05 606 67 5.740000E-02 3.320000E-02 9.380000E-05 606 68 5.790000E-02 3.260000E-02 9.300000E-05 606 69 5.850000E-02 3.180000E-02 9.290000E-05 606 70 5.910000E-02 3.110000E-02 9.280000E-05 606 71 5.960000E-02 3.040000E-02 9.200000E-05 606 72 6.020000E-02 2.970000E-02 9.130000E-05 606 73 6.080000E-02 2.920000E-02 9.150000E-05 606 74 6.130000E-02 2.850000E-02 9.090000E-05 606 75 6.190000E-02 2.790000E-02 9.090000E-05 606 76 6.250000E-02 2.720000E-02 8.950000E-05 606 77 6.300000E-02 2.650000E-02 8.940000E-05 606 78 6.360000E-02 2.600000E-02 8.870000E-05 606 79 6.420000E-02 2.550000E-02 8.880000E-05 606 80 6.470000E-02 2.500000E-02 8.780000E-05 606 81 6.530000E-02 2.430000E-02 8.760000E-05 606 82 6.590000E-02 2.380000E-02 8.730000E-05 606 83 6.640000E-02 2.330000E-02 8.730000E-05 606 84 6.700000E-02 2.270000E-02 8.590000E-05 606 85 6.760000E-02 2.220000E-02 8.450000E-05 606 86 6.820000E-02 2.170000E-02 8.290000E-05 606 87 6.870000E-02 2.120000E-02 8.240000E-05 606 88 6.930000E-02 2.080000E-02 8.090000E-05 606 89 6.990000E-02 2.020000E-02 8.020000E-05 606 90 7.040000E-02 1.980000E-02 7.880000E-05 606 91 7.100000E-02 1.930000E-02 7.790000E-05 606 92 7.160000E-02 1.890000E-02 7.740000E-05 606 93 7.210000E-02 1.850000E-02 7.610000E-05 606 94 7.270000E-02 1.800000E-02 7.560000E-05 606 95 7.330000E-02 1.760000E-02 7.420000E-05 606 96 7.380000E-02 1.720000E-02 7.360000E-05 606 97 7.440000E-02 1.680000E-02 7.280000E-05 606 98 7.500000E-02 1.640000E-02 7.170000E-05 606 99 7.550000E-02 1.600000E-02 7.100000E-05 606 100 7.610000E-02 1.560000E-02 7.030000E-05 606 101 7.670000E-02 1.520000E-02 6.950000E-05 606 102 7.720000E-02 1.500000E-02 6.870000E-05 606 103 7.780000E-02 1.460000E-02 6.790000E-05 606 104 7.840000E-02 1.420000E-02 6.740000E-05 606 105 7.890000E-02 1.390000E-02 6.650000E-05 606 106 7.950000E-02 1.370000E-02 6.600000E-05 606 107 8.010000E-02 1.330000E-02 6.520000E-05 606 108 8.060000E-02 1.300000E-02 6.440000E-05 606 109 8.120000E-02 1.270000E-02 6.390000E-05 606 110 8.180000E-02 1.240000E-02 6.320000E-05 606 111 8.230000E-02 1.210000E-02 6.270000E-05 606 112 8.290000E-02 1.190000E-02 6.190000E-05 606 113 8.350000E-02 1.160000E-02 6.140000E-05 606 114 8.410000E-02 1.130000E-02 6.080000E-05 606 115 8.460000E-02 1.110000E-02 6.010000E-05 606 116 8.520000E-02 1.070000E-02 5.980000E-05 606 117 8.580000E-02 1.050000E-02 5.890000E-05 606 118 8.630000E-02 1.020000E-02 5.860000E-05 606 119 8.690000E-02 1.000000E-02 5.810000E-05 606 120 8.750000E-02 9.840000E-03 5.730000E-05 606 121 8.800000E-02 9.630000E-03 5.700000E-05 606 122 8.860000E-02 9.420000E-03 5.620000E-05 606 123 8.920000E-02 9.170000E-03 5.610000E-05 606 124 8.970000E-02 9.000000E-03 5.530000E-05 606 125 9.030000E-02 8.820000E-03 5.480000E-05 606 126 9.090000E-02 8.580000E-03 5.530000E-05 606 127 9.140000E-02 8.380000E-03 5.530000E-05 606 128 9.200000E-02 8.190000E-03 5.560000E-05 606 129 9.260000E-02 7.980000E-03 5.510000E-05 606 130 9.310000E-02 7.810000E-03 5.530000E-05 606 131 9.370000E-02 7.630000E-03 5.510000E-05 606 132 9.430000E-02 7.440000E-03 5.480000E-05 606 133 9.480000E-02 7.290000E-03 5.450000E-05 606 134 9.540000E-02 7.110000E-03 5.400000E-05 606 135 9.600000E-02 6.960000E-03 5.450000E-05 606 136 9.650000E-02 6.780000E-03 5.510000E-05 606 137 9.710000E-02 6.660000E-03 5.530000E-05 606 138 9.770000E-02 6.500000E-03 5.580000E-05 606 139 9.820000E-02 6.310000E-03 5.580000E-05 606 140 9.880000E-02 6.110000E-03 5.610000E-05 606 141 9.940000E-02 6.010000E-03 5.580000E-05 606 142 9.990000E-02 5.940000E-03 5.610000E-05 606 143 1.010000E-01 5.790000E-03 5.610000E-05 606 144 1.010000E-01 5.640000E-03 5.610000E-05 606 145 1.020000E-01 5.530000E-03 5.610000E-05 606 146 1.020000E-01 5.410000E-03 5.480000E-05 606 147 1.030000E-01 5.270000E-03 5.430000E-05 606 148 1.030000E-01 5.110000E-03 5.350000E-05 606 149 1.040000E-01 5.010000E-03 5.300000E-05 606 150 1.040000E-01 4.880000E-03 5.270000E-05 606 151 1.050000E-01 4.730000E-03 5.230000E-05 606 152 1.060000E-01 4.630000E-03 5.230000E-05 606 153 1.060000E-01 4.530000E-03 5.180000E-05 606 154 1.070000E-01 4.430000E-03 5.150000E-05 606 155 1.070000E-01 4.350000E-03 5.120000E-05 606 156 1.080000E-01 4.260000E-03 5.100000E-05 606 157 1.080000E-01 4.150000E-03 5.070000E-05 606 158 1.090000E-01 4.070000E-03 5.050000E-05 606 159 1.100000E-01 3.960000E-03 5.020000E-05 606 160 1.100000E-01 3.880000E-03 4.990000E-05 606 161 1.110000E-01 3.740000E-03 4.970000E-05 606 162 1.110000E-01 3.650000E-03 4.950000E-05 606 163 1.120000E-01 3.560000E-03 4.910000E-05 606 164 1.120000E-01 3.470000E-03 4.910000E-05 606 165 1.130000E-01 3.390000E-03 4.880000E-05 606 166 1.140000E-01 3.300000E-03 4.850000E-05 606 167 1.140000E-01 3.220000E-03 4.850000E-05 606 168 1.150000E-01 3.140000E-03 4.810000E-05 606 169 1.150000E-01 3.070000E-03 4.810000E-05 606 170 1.160000E-01 3.010000E-03 4.770000E-05 606 171 1.160000E-01 2.940000E-03 4.770000E-05 606 172 1.170000E-01 2.940000E-03 4.740000E-05 606 173 1.180000E-01 2.880000E-03 4.720000E-05 606 174 1.180000E-01 2.800000E-03 4.720000E-05 606 175 1.190000E-01 2.760000E-03 4.680000E-05 606 176 1.190000E-01 2.690000E-03 4.660000E-05 606 177 1.200000E-01 2.630000E-03 4.650000E-05 606 178 1.200000E-01 2.590000E-03 4.630000E-05 606 179 1.210000E-01 2.510000E-03 4.610000E-05 606 180 1.220000E-01 2.420000E-03 4.590000E-05 606 181 1.220000E-01 2.380000E-03 4.590000E-05 606 182 1.230000E-01 2.350000E-03 4.560000E-05 606 183 1.230000E-01 2.300000E-03 4.550000E-05 606 184 1.240000E-01 2.290000E-03 4.530000E-05 606 185 1.240000E-01 2.220000E-03 4.510000E-05 606 186 1.250000E-01 2.130000E-03 4.490000E-05 606 187 1.250000E-01 2.090000E-03 4.470000E-05 606 188 1.260000E-01 2.060000E-03 4.450000E-05 606 189 1.270000E-01 2.000000E-03 4.430000E-05 606 190 1.270000E-01 1.960000E-03 4.420000E-05 606 191 1.280000E-01 1.870000E-03 4.390000E-05 606 192 1.280000E-01 1.830000E-03 4.360000E-05 606 193 1.290000E-01 1.800000E-03 4.360000E-05 606 194 1.290000E-01 1.810000E-03 4.350000E-05 606 195 1.300000E-01 1.810000E-03 4.340000E-05 606 196 1.310000E-01 1.760000E-03 4.320000E-05 606 197 1.310000E-01 1.700000E-03 4.310000E-05 606 198 1.320000E-01 1.670000E-03 4.300000E-05 606 199 1.320000E-01 1.630000E-03 4.280000E-05 606 200 1.330000E-01 1.620000E-03 4.270000E-05 606 201 1.330000E-01 1.580000E-03 4.260000E-05 606 202 1.340000E-01 1.550000E-03 4.240000E-05 606 203 1.350000E-01 1.480000E-03 4.240000E-05 606 204 1.350000E-01 1.500000E-03 4.220000E-05 606 205 1.360000E-01 1.460000E-03 4.220000E-05 606 206 1.360000E-01 1.420000E-03 4.200000E-05 606 207 1.370000E-01 1.390000E-03 4.190000E-05 606 208 1.370000E-01 1.390000E-03 4.190000E-05 606 209 1.380000E-01 1.380000E-03 4.170000E-05 606 210 1.390000E-01 1.350000E-03 4.170000E-05 606 211 1.390000E-01 1.310000E-03 4.150000E-05 606 212 1.400000E-01 1.310000E-03 4.140000E-05 606 213 1.400000E-01 1.310000E-03 4.140000E-05 606 214 1.410000E-01 1.290000E-03 4.110000E-05 606 215 1.410000E-01 1.250000E-03 4.110000E-05 606 216 1.420000E-01 1.220000E-03 4.100000E-05 606 217 1.430000E-01 1.190000E-03 4.100000E-05 606 218 1.430000E-01 1.170000E-03 4.090000E-05 606 219 1.440000E-01 1.180000E-03 4.070000E-05 606 220 1.440000E-01 1.150000E-03 4.070000E-05 606 221 1.450000E-01 1.120000E-03 4.050000E-05 606 222 1.450000E-01 1.130000E-03 4.050000E-05 606 223 1.460000E-01 1.100000E-03 4.030000E-05 606 224 1.460000E-01 1.070000E-03 4.030000E-05 606 225 1.470000E-01 1.050000E-03 4.020000E-05 606 226 1.480000E-01 1.020000E-03 4.010000E-05 606 227 1.480000E-01 1.000000E-03 4.010000E-05 606 228 1.490000E-01 1.010000E-03 3.990000E-05 606 229 1.490000E-01 9.950000E-04 3.990000E-05 606 230 1.500000E-01 9.740000E-04 3.980000E-05 606 231 1.500000E-01 9.400000E-04 3.970000E-05 606 232 1.510000E-01 9.210000E-04 3.970000E-05 606 233 1.520000E-01 9.460000E-04 3.960000E-05 606 234 1.520000E-01 9.410000E-04 3.960000E-05 606 235 1.530000E-01 9.170000E-04 3.940000E-05 606 236 1.530000E-01 9.030000E-04 3.930000E-05 606 237 1.540000E-01 8.740000E-04 3.930000E-05 606 238 1.540000E-01 8.590000E-04 3.920000E-05 606 239 1.550000E-01 8.790000E-04 3.920000E-05 606 240 1.560000E-01 8.920000E-04 3.900000E-05 606 241 1.560000E-01 8.700000E-04 3.900000E-05 606 242 1.570000E-01 8.610000E-04 3.890000E-05 606 243 1.570000E-01 8.320000E-04 3.880000E-05 606 244 1.580000E-01 8.160000E-04 3.880000E-05 606 245 1.580000E-01 8.270000E-04 3.860000E-05 606 246 1.590000E-01 8.230000E-04 3.860000E-05 606 247 1.600000E-01 8.000000E-04 3.850000E-05 606 248 1.600000E-01 7.920000E-04 3.850000E-05 606 249 1.610000E-01 7.810000E-04 3.840000E-05 606 250 1.610000E-01 7.690000E-04 3.840000E-05 606 251 1.620000E-01 7.530000E-04 3.840000E-05 606 252 1.620000E-01 7.410000E-04 3.810000E-05 606 253 1.630000E-01 7.580000E-04 3.810000E-05 606 254 1.640000E-01 7.620000E-04 3.810000E-05 606 255 1.640000E-01 6.950000E-04 3.800000E-05 606 256 1.650000E-01 6.850000E-04 3.800000E-05 606 257 1.650000E-01 6.680000E-04 3.780000E-05 606 258 1.660000E-01 6.980000E-04 3.780000E-05 606 259 1.660000E-01 7.030000E-04 3.770000E-05 606 260 1.670000E-01 7.000000E-04 3.760000E-05 606 261 1.670000E-01 7.230000E-04 3.760000E-05 606 262 1.680000E-01 7.210000E-04 3.740000E-05 606 263 1.690000E-01 7.400000E-04 3.740000E-05 606 264 1.690000E-01 7.450000E-04 3.730000E-05 606 265 1.700000E-01 7.240000E-04 3.730000E-05 606 266 1.700000E-01 7.120000E-04 3.730000E-05 606 267 1.710000E-01 7.060000E-04 3.720000E-05 606 268 1.710000E-01 6.830000E-04 3.720000E-05 606 269 1.720000E-01 6.730000E-04 3.710000E-05 606 270 1.730000E-01 6.660000E-04 3.710000E-05 606 271 1.730000E-01 6.680000E-04 3.710000E-05 606 272 1.740000E-01 6.900000E-04 3.690000E-05 606 273 1.740000E-01 6.810000E-04 3.690000E-05 606 274 1.750000E-01 7.110000E-04 3.680000E-05 606 275 1.750000E-01 6.920000E-04 3.680000E-05 606 276 1.760000E-01 6.640000E-04 3.670000E-05 606 277 1.770000E-01 6.350000E-04 3.670000E-05 606 278 1.770000E-01 6.480000E-04 3.650000E-05 606 279 1.780000E-01 6.570000E-04 3.650000E-05 606 280 1.780000E-01 6.330000E-04 3.650000E-05 606 281 1.790000E-01 6.070000E-04 3.640000E-05 606 282 1.790000E-01 6.100000E-04 3.640000E-05 606 283 1.800000E-01 6.080000E-04 3.630000E-05 606 284 1.810000E-01 6.250000E-04 3.610000E-05 606 285 1.810000E-01 6.270000E-04 3.610000E-05 606 286 1.820000E-01 6.100000E-04 3.610000E-05 606 287 1.820000E-01 6.030000E-04 3.610000E-05 606 288 1.830000E-01 5.910000E-04 3.600000E-05 606 289 1.830000E-01 5.720000E-04 3.590000E-05 606 290 1.840000E-01 5.510000E-04 3.590000E-05 606 291 1.850000E-01 5.690000E-04 3.590000E-05 606 292 1.850000E-01 6.010000E-04 3.590000E-05 606 293 1.860000E-01 5.870000E-04 3.570000E-05 606 294 1.860000E-01 5.900000E-04 3.570000E-05 606 295 1.870000E-01 5.950000E-04 3.560000E-05 606 296 1.870000E-01 6.040000E-04 3.560000E-05 606 297 1.880000E-01 6.150000E-04 3.560000E-05 606 298 1.880000E-01 5.900000E-04 3.550000E-05 606 299 1.890000E-01 5.700000E-04 3.550000E-05 606 300 1.900000E-01 5.810000E-04 3.550000E-05 606 301 1.900000E-01 6.270000E-04 3.530000E-05 606 302 1.910000E-01 6.190000E-04 3.530000E-05 606 303 1.910000E-01 6.150000E-04 3.520000E-05 606 304 1.920000E-01 6.190000E-04 3.520000E-05 606 305 1.920000E-01 5.900000E-04 3.510000E-05 606 306 1.930000E-01 5.740000E-04 3.510000E-05 606 307 1.940000E-01 6.100000E-04 3.510000E-05 606 308 1.940000E-01 5.980000E-04 3.500000E-05 606 309 1.950000E-01 5.970000E-04 3.510000E-05 606 310 1.950000E-01 5.930000E-04 3.500000E-05 606 311 1.960000E-01 5.810000E-04 3.500000E-05 606 312 1.960000E-01 5.320000E-04 3.500000E-05 606 313 1.970000E-01 5.300000E-04 3.480000E-05 606 314 1.980000E-01 5.150000E-04 3.480000E-05 606 315 1.980000E-01 5.320000E-04 3.470000E-05 606 316 1.990000E-01 5.330000E-04 3.470000E-05 606 317 1.990000E-01 5.300000E-04 3.470000E-05 606 318 2.000000E-01 5.100000E-04 3.460000E-05 606 319 2.000000E-01 5.070000E-04 3.460000E-05 606 320 2.010000E-01 5.110000E-04 3.440000E-05 606 321 2.020000E-01 5.160000E-04 3.460000E-05 606 322 2.020000E-01 5.110000E-04 3.440000E-05 606 323 2.030000E-01 5.240000E-04 3.430000E-05 606 324 2.030000E-01 5.400000E-04 3.430000E-05 606 325 2.040000E-01 5.020000E-04 3.430000E-05 606 326 2.040000E-01 4.910000E-04 3.430000E-05 606 327 2.050000E-01 4.760000E-04 3.420000E-05 606 328 2.060000E-01 4.910000E-04 3.420000E-05 606 329 2.060000E-01 4.890000E-04 3.420000E-05 606 330 2.070000E-01 4.880000E-04 3.400000E-05 606 331 2.070000E-01 4.980000E-04 3.400000E-05 606 332 2.080000E-01 4.930000E-04 3.390000E-05 606 333 2.080000E-01 4.800000E-04 3.390000E-05 606 334 2.090000E-01 4.890000E-04 3.390000E-05 606 335 2.090000E-01 4.800000E-04 3.390000E-05 606 336 2.100000E-01 4.730000E-04 3.380000E-05 606 337 2.110000E-01 4.810000E-04 3.380000E-05 606 338 2.110000E-01 5.060000E-04 3.380000E-05 606 339 2.120000E-01 4.890000E-04 3.360000E-05 606 340 2.120000E-01 4.650000E-04 3.360000E-05 606 341 2.130000E-01 4.700000E-04 3.360000E-05 606 342 2.130000E-01 4.630000E-04 3.350000E-05 606 343 2.140000E-01 4.360000E-04 3.350000E-05 606 344 2.150000E-01 4.180000E-04 3.350000E-05 606 345 2.150000E-01 4.190000E-04 3.350000E-05 606 346 2.160000E-01 4.530000E-04 3.340000E-05 606 347 2.160000E-01 4.680000E-04 3.340000E-05 606 348 2.170000E-01 4.560000E-04 3.340000E-05 606 349 2.170000E-01 4.280000E-04 3.320000E-05 606 350 2.180000E-01 3.800000E-04 3.320000E-05 606 351 2.190000E-01 3.800000E-04 3.320000E-05 606 352 2.190000E-01 4.020000E-04 3.310000E-05 606 353 2.200000E-01 3.940000E-04 3.310000E-05 606 354 2.200000E-01 3.420000E-04 3.310000E-05 606 355 2.210000E-01 3.520000E-04 3.310000E-05 606 356 2.210000E-01 3.710000E-04 3.300000E-05 606 357 2.220000E-01 4.130000E-04 3.300000E-05 606 358 2.230000E-01 4.060000E-04 3.290000E-05 606 359 2.230000E-01 3.990000E-04 3.290000E-05 606 360 2.240000E-01 3.840000E-04 3.320000E-05 606 361 2.240000E-01 3.600000E-04 3.360000E-05 606 362 2.250000E-01 3.460000E-04 3.390000E-05 606 363 2.250000E-01 3.930000E-04 3.400000E-05 606 364 2.260000E-01 3.960000E-04 3.420000E-05 606 365 2.260000E-01 3.440000E-04 3.430000E-05 606 366 2.270000E-01 3.320000E-04 3.440000E-05 606 367 2.280000E-01 3.050000E-04 3.460000E-05 606 368 2.280000E-01 3.430000E-04 3.470000E-05 606 369 2.290000E-01 3.230000E-04 3.520000E-05 606 370 2.290000E-01 3.300000E-04 3.570000E-05 606 371 2.300000E-01 3.150000E-04 3.630000E-05 606 372 2.300000E-01 3.390000E-04 3.650000E-05 606 373 2.310000E-01 3.440000E-04 3.680000E-05 606 374 2.320000E-01 3.420000E-04 3.690000E-05 606 375 2.320000E-01 3.310000E-04 3.710000E-05 606 376 2.330000E-01 3.130000E-04 3.730000E-05 606 377 2.330000E-01 3.210000E-04 3.760000E-05 606 378 2.340000E-01 3.170000E-04 3.760000E-05 606 379 2.340000E-01 3.210000E-04 3.800000E-05 606 380 2.350000E-01 3.230000E-04 3.800000E-05 606 381 2.360000E-01 3.420000E-04 3.820000E-05 606 382 2.360000E-01 3.110000E-04 3.840000E-05 606 383 2.370000E-01 3.070000E-04 3.840000E-05 606 384 2.370000E-01 3.140000E-04 3.780000E-05 606 385 2.380000E-01 2.930000E-04 3.730000E-05 606 386 2.380000E-01 3.150000E-04 3.720000E-05 606 387 2.390000E-01 3.180000E-04 3.690000E-05 606 388 2.400000E-01 2.940000E-04 3.680000E-05 606 389 2.400000E-01 2.980000E-04 3.680000E-05 606 390 2.410000E-01 3.090000E-04 3.670000E-05 606 391 2.410000E-01 2.980000E-04 3.670000E-05 606 392 2.420000E-01 2.790000E-04 3.650000E-05 606 393 2.420000E-01 3.100000E-04 3.640000E-05 606 394 2.430000E-01 2.880000E-04 3.640000E-05 606 395 2.440000E-01 3.060000E-04 3.630000E-05 606 396 2.440000E-01 2.940000E-04 3.630000E-05 606 397 2.450000E-01 2.810000E-04 3.610000E-05 606 398 2.450000E-01 2.610000E-04 3.610000E-05 606 399 2.460000E-01 2.480000E-04 3.600000E-05 606 400 2.460000E-01 2.690000E-04 3.600000E-05 606 401 2.470000E-01 2.810000E-04 3.610000E-05 606 402 2.470000E-01 2.520000E-04 3.600000E-05 606 403 2.480000E-01 2.460000E-04 3.600000E-05 606 404 2.490000E-01 2.230000E-04 3.590000E-05 606 405 2.490000E-01 2.340000E-04 3.590000E-05 606 406 2.500000E-01 2.580000E-04 3.590000E-05 606 407 2.500000E-01 2.550000E-04 3.570000E-05 606 408 2.510000E-01 2.540000E-04 3.590000E-05 606 409 2.510000E-01 2.470000E-04 3.590000E-05 606 410 2.520000E-01 2.580000E-04 3.590000E-05 606 411 2.530000E-01 2.480000E-04 3.590000E-05 606 412 2.530000E-01 2.300000E-04 3.570000E-05 606 413 2.540000E-01 2.540000E-04 3.590000E-05 606 414 2.540000E-01 2.830000E-04 3.570000E-05 606 415 2.550000E-01 2.860000E-04 3.570000E-05 606 416 2.550000E-01 2.600000E-04 3.570000E-05 606 417 2.560000E-01 2.470000E-04 3.560000E-05 606 418 2.570000E-01 2.290000E-04 3.570000E-05 606 419 2.570000E-01 2.470000E-04 3.560000E-05 606 420 2.580000E-01 2.390000E-04 3.560000E-05 606 421 2.580000E-01 2.370000E-04 3.560000E-05 606 422 2.590000E-01 2.270000E-04 3.560000E-05 606 423 2.590000E-01 2.510000E-04 3.560000E-05 606 424 2.600000E-01 2.650000E-04 3.550000E-05 606 425 2.610000E-01 2.480000E-04 3.560000E-05 606 426 2.610000E-01 2.650000E-04 3.550000E-05 606 427 2.620000E-01 2.590000E-04 3.550000E-05 606 428 2.620000E-01 2.940000E-04 3.550000E-05 606 429 2.630000E-01 3.050000E-04 3.530000E-05 606 430 2.630000E-01 2.830000E-04 3.550000E-05 606 431 2.640000E-01 2.730000E-04 3.530000E-05 606 432 2.640000E-01 2.940000E-04 3.530000E-05 606 433 2.650000E-01 2.710000E-04 3.530000E-05 606 434 2.660000E-01 2.420000E-04 3.530000E-05 606 435 2.660000E-01 2.430000E-04 3.530000E-05 606 436 2.670000E-01 2.710000E-04 3.520000E-05 606 437 2.670000E-01 2.610000E-04 3.520000E-05 606 438 2.680000E-01 2.350000E-04 3.520000E-05 606 439 2.680000E-01 2.120000E-04 3.520000E-05 606 440 2.690000E-01 2.180000E-04 3.520000E-05 606 441 2.700000E-01 2.380000E-04 3.520000E-05 606 442 2.700000E-01 2.650000E-04 3.520000E-05 606 443 2.710000E-01 2.750000E-04 3.510000E-05 606 444 2.710000E-01 2.860000E-04 3.520000E-05 606 445 2.720000E-01 2.480000E-04 3.510000E-05 606 446 2.720000E-01 2.300000E-04 3.510000E-05 606 447 2.730000E-01 2.260000E-04 3.510000E-05 606 448 2.740000E-01 2.040000E-04 3.510000E-05 606 449 2.740000E-01 2.500000E-04 3.510000E-05 606 450 2.750000E-01 3.000000E-04 3.500000E-05 606 451 2.750000E-01 2.580000E-04 3.510000E-05 606 452 2.760000E-01 2.640000E-04 3.510000E-05 606 453 2.760000E-01 2.540000E-04 3.500000E-05 606 454 2.770000E-01 2.160000E-04 3.500000E-05 606 455 2.780000E-01 2.500000E-04 3.480000E-05 606 456 2.780000E-01 2.500000E-04 3.500000E-05 606 457 2.790000E-01 2.480000E-04 3.500000E-05 606 458 2.790000E-01 2.690000E-04 3.480000E-05 606 459 2.800000E-01 2.680000E-04 3.500000E-05 606 460 2.800000E-01 2.640000E-04 3.480000E-05 606 461 2.810000E-01 2.350000E-04 3.480000E-05 606 462 2.810000E-01 2.270000E-04 3.470000E-05 606 463 2.820000E-01 2.440000E-04 3.470000E-05 606 464 2.830000E-01 2.370000E-04 3.470000E-05 606 465 2.830000E-01 2.850000E-04 3.470000E-05 606 466 2.840000E-01 2.750000E-04 3.470000E-05 606 467 2.840000E-01 2.600000E-04 3.470000E-05 606 468 2.850000E-01 2.600000E-04 3.470000E-05 606 469 2.850000E-01 2.790000E-04 3.470000E-05 606 470 2.860000E-01 2.540000E-04 3.460000E-05 606 471 2.870000E-01 2.590000E-04 3.470000E-05 606 472 2.870000E-01 2.800000E-04 3.460000E-05 606 473 2.880000E-01 3.090000E-04 3.460000E-05 606 474 2.880000E-01 3.090000E-04 3.460000E-05 606 475 2.890000E-01 2.770000E-04 3.460000E-05 606 476 2.890000E-01 2.610000E-04 3.460000E-05 606 477 2.900000E-01 2.650000E-04 3.460000E-05 606 478 2.910000E-01 2.680000E-04 3.460000E-05 606 479 2.910000E-01 2.500000E-04 3.440000E-05 606 480 2.920000E-01 1.960000E-04 3.460000E-05 606 481 2.920000E-01 2.080000E-04 3.440000E-05 606 482 2.930000E-01 2.480000E-04 3.440000E-05 606 483 2.930000E-01 2.430000E-04 3.440000E-05 606 484 2.940000E-01 2.440000E-04 3.440000E-05 606 485 2.950000E-01 2.540000E-04 3.440000E-05 606 486 2.950000E-01 2.710000E-04 3.440000E-05 606 487 2.960000E-01 2.640000E-04 3.430000E-05 606 488 2.960000E-01 2.270000E-04 3.440000E-05 606 489 2.970000E-01 2.290000E-04 3.430000E-05 606 490 2.970000E-01 2.400000E-04 3.430000E-05 606 491 2.980000E-01 2.590000E-04 3.430000E-05 606 492 2.980000E-01 2.460000E-04 3.430000E-05 606 493 2.990000E-01 2.100000E-04 3.430000E-05 606 494 3.000000E-01 2.230000E-04 3.420000E-05 606 495 3.000000E-01 2.230000E-04 3.430000E-05 606 496 3.010000E-01 2.160000E-04 3.420000E-05 606 497 3.010000E-01 2.210000E-04 3.420000E-05 606 498 3.020000E-01 2.290000E-04 3.420000E-05 606 499 3.020000E-01 2.440000E-04 3.420000E-05 606 500 3.030000E-01 2.680000E-04 3.420000E-05 606 501 3.040000E-01 2.650000E-04 3.400000E-05 606 502 3.040000E-01 2.680000E-04 3.420000E-05 606 503 3.050000E-01 2.750000E-04 3.400000E-05 606 504 3.050000E-01 2.600000E-04 3.420000E-05 606 505 3.060000E-01 2.770000E-04 3.400000E-05 606 506 3.060000E-01 2.840000E-04 3.400000E-05 606 #