data_SASDDX8_MAIN # _sas_result.id 990 _sas_result.SASBDB_code SASDDX8 _sas_result.experimental_MW 43.000 _sas_result.experimental_MW_error . _sas_result.MW_standard . _sas_result.MW_standard_error . _sas_result.MW_Porod . _sas_result.MW_Porod_error . _sas_result.I0_from_PR . _sas_result.I0_from_PR_error . _sas_result.I0_from_Guinier 1.3200000000 _sas_result.I0_from_Guinier_error . _sas_result.Rg_from_PR 2.000 _sas_result.Rg_from_PR_error . _sas_result.Rg_from_Guinier . _sas_result.Rg_from_Guinier_error . _sas_result.D_max . _sas_result.Porod_volume . _sas_result.Porod_volume_error . _sas_result.estimated_volume . _sas_result.estimated_volume_error . _sas_result.estimated_volume_method . _sas_result.Guinier_point_min . _sas_result.Guinier_point_max . _sas_result.type_of_curve single_conc _sas_result.standard . _sas_result.Dmax_error . _sas_result.comments . # _sas_scan.title "Raw chicken egg albumen" _sas_scan.detc_id 62 _sas_scan.id 990 _sas_scan.measurement_date 2013-06-27 _sas_scan.storage_temperature 4.0 _sas_scan.cell_temperature 10.0 _sas_scan.exposure_time 1800.000 _sas_scan.number_of_frames 1 _sas_scan.unit 1/A _sas_scan.qmin 0.0080 _sas_scan.qmax 0.3280 _sas_scan.sample_id 950 _sas_scan.result_id 990 _sas_scan.beam_id 85 # _sas_beam.id 85 _sas_beam.instrument_name "University of Pennslyvania Bruker Nonius FR591" _sas_beam.instrument_city "Philadelphia, PA" _sas_beam.instrument_country "United States" _sas_beam.shape . _sas_beam.type_of_source "X-ray in house" _sas_beam.radiation_wavelength 0.154200 _sas_beam.dist_spec_to_detc 1.50000 # _sas_detc.id 62 _sas_detc.name "Bruker Hi-Star multiwire detector" _sas_detc.type . _sas_detc.pixsize_x . # _sas_sample.id 950 _sas_sample.name "Raw chicken egg albumen" _sas_sample.ext_coefficient . _sas_sample.contrast . _sas_sample.specific_vol . _sas_sample.purity_method . _sas_sample.dry_vol . _sas_sample.sample_MW . _sas_sample.specimen_concentration 170.00 _sas_sample.concentration_method . _sas_sample.entity_id 1155 # _sas_buffer.id 612 _sas_buffer.name Water _sas_buffer.concentration . _sas_buffer.unit . _sas_buffer.pK . _sas_buffer.pH 7.000 _sas_buffer.comment . _sas_buffer.composition . _sas_buffer.sample_id 950 # _entity.id 1155 _entity.type protein _entity.pdbx_description Ovalbumin _entity.formula_weight 42.750 _entity.pdbx_number_of_molecules 1 # _entity_name_com.entity_id 1155 _entity_name_com.name Ova # _entity_poly.entity_id 1155 _entity_poly.pdbx_seq_one_letter_code ;GSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRFDKLPGFGDSIEAQCGTSVNV HSSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYLQCVKELYRGGLEPINFQTAADQARELINSWVESQTNGIIRN VLQPSSVDSQTAMVLVNAIVFKGLWEKAFKDEDTQAMPFRVTEQESKPVQMMYQIGLFRVASMASEKMKILELPFASGTM SMLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSVLMAMGITDVFSSSANLSGISSAE SLKISQAVHAAHAEINEAGREVVGSAEAGVDAASVSEEFRADHPFLFCIKHIATNAVLFFGRCVSP ; # _entity_src_gen.entity_id 1155 _entity_src_gen.gene_src_common_name "Gallus gallus" # _struct_ref.id 1 _struct_ref.entity_id 1155 _struct_ref.db_name UniProt _struct_ref.db_code P01012 _struct_ref.details http://www.uniprot.org/uniprot/P01012 # _citation.id 365 _citation.title "The Proof Is in the Pidan: Generalizing Proteins as Patchy Particles" _citation.year "2018 Jun 28" _citation.pdbx_database_id_DOI 10.1021/acscentsci.8b00187 _citation.pdbx_database_id_PubMed . # _citation_author.citation_id 365 _citation_author.ordinal 1 loop_ _citation_author.name "Cai J" "Sweeney A" # _pdbx_contact_author.id 162 _pdbx_contact_author.name_first Jing _pdbx_contact_author.name_last Cai _pdbx_contact_author.role . _pdbx_contact_author.address_1 Penn _pdbx_contact_author.address_2 "University of Pennsylvania" _pdbx_contact_author.address_3 "Philadelphia, PA, United States" # loop_ _sas_scan_intensity.id _sas_scan_intensity.momentum_transfer _sas_scan_intensity.intensity _sas_scan_intensity.intensity_su_counting _sas_scan_intensity.scan_id 1 8.000000E-03 1.368200E+00 3.464580E-02 990 2 1.000000E-02 1.307700E+00 3.473360E-02 990 3 1.200000E-02 1.329100E+00 3.477030E-02 990 4 1.400000E-02 1.250000E+00 3.475650E-02 990 5 1.600000E-02 1.356800E+00 3.469240E-02 990 6 1.800000E-02 1.256400E+00 3.457860E-02 990 7 2.000000E-02 1.204500E+00 3.441560E-02 990 8 2.200000E-02 1.279300E+00 3.420360E-02 990 9 2.400000E-02 1.288200E+00 3.394320E-02 990 10 2.600000E-02 1.246400E+00 3.363480E-02 990 11 2.800000E-02 1.224300E+00 3.327890E-02 990 12 3.000000E-02 1.235700E+00 3.287590E-02 990 13 3.200000E-02 1.214400E+00 3.242610E-02 990 14 3.400000E-02 1.130300E+00 3.301800E-02 990 15 3.600000E-02 1.222400E+00 3.187570E-02 990 16 3.800000E-02 1.140500E+00 2.917150E-02 990 17 4.000000E-02 1.103200E+00 2.719850E-02 990 18 4.200000E-02 1.104100E+00 2.814190E-02 990 19 4.400000E-02 1.116400E+00 2.758880E-02 990 20 4.600000E-02 1.079600E+00 2.865640E-02 990 21 4.800000E-02 1.150800E+00 2.757110E-02 990 22 5.000000E-02 1.040300E+00 2.681840E-02 990 23 5.200000E-02 1.075200E+00 2.315390E-02 990 24 5.400000E-02 1.084500E+00 2.069620E-02 990 25 5.600000E-02 1.092000E+00 1.907710E-02 990 26 5.800000E-02 1.061700E+00 1.641510E-02 990 27 6.000000E-02 1.043700E+00 1.626750E-02 990 28 6.200000E-02 1.029700E+00 1.657430E-02 990 29 6.400000E-02 1.050000E+00 1.496590E-02 990 30 6.600000E-02 9.827000E-01 1.459810E-02 990 31 6.800000E-02 9.621500E-01 1.311780E-02 990 32 7.000000E-02 9.540600E-01 1.071660E-02 990 33 7.200000E-02 9.082100E-01 1.025270E-02 990 34 7.400000E-02 8.638000E-01 1.073520E-02 990 35 7.600000E-02 8.092700E-01 1.211720E-02 990 36 7.800000E-02 8.213400E-01 1.191410E-02 990 37 8.000000E-02 7.932200E-01 1.087180E-02 990 38 8.200000E-02 7.688200E-01 1.139340E-02 990 39 8.400000E-02 7.155800E-01 1.060350E-02 990 40 8.600000E-02 6.732700E-01 9.891170E-03 990 41 8.800000E-02 6.505700E-01 8.334250E-03 990 42 9.000000E-02 6.153400E-01 1.000940E-02 990 43 9.200000E-02 6.054100E-01 9.235980E-03 990 44 9.400000E-02 5.665300E-01 8.381780E-03 990 45 9.600000E-02 5.292900E-01 8.199440E-03 990 46 9.800000E-02 4.914000E-01 6.875240E-03 990 47 1.000000E-01 4.831300E-01 6.592020E-03 990 48 1.020000E-01 4.451800E-01 7.981880E-03 990 49 1.040000E-01 4.035200E-01 7.545060E-03 990 50 1.060000E-01 3.847800E-01 6.892520E-03 990 51 1.080000E-01 3.564800E-01 6.880130E-03 990 52 1.100000E-01 3.433700E-01 6.511590E-03 990 53 1.120000E-01 3.363500E-01 6.417670E-03 990 54 1.140000E-01 3.076500E-01 5.857470E-03 990 55 1.160000E-01 2.913600E-01 5.190030E-03 990 56 1.180000E-01 2.664800E-01 5.134740E-03 990 57 1.200000E-01 2.460300E-01 4.962030E-03 990 58 1.220000E-01 2.315200E-01 4.341230E-03 990 59 1.240000E-01 2.244200E-01 3.799350E-03 990 60 1.260000E-01 2.111800E-01 3.658820E-03 990 61 1.280000E-01 2.015700E-01 3.272050E-03 990 62 1.300000E-01 1.828200E-01 3.452840E-03 990 63 1.320000E-01 1.890200E-01 3.338240E-03 990 64 1.340000E-01 1.711600E-01 3.296500E-03 990 65 1.360000E-01 1.597300E-01 2.672340E-03 990 66 1.380000E-01 1.558400E-01 3.004650E-03 990 67 1.400000E-01 1.454700E-01 2.990170E-03 990 68 1.420000E-01 1.468900E-01 3.281970E-03 990 69 1.440000E-01 1.322000E-01 3.121980E-03 990 70 1.460000E-01 1.266600E-01 3.347760E-03 990 71 1.480000E-01 1.267700E-01 3.439640E-03 990 72 1.500000E-01 1.233700E-01 3.193330E-03 990 73 1.520000E-01 1.105000E-01 2.948670E-03 990 74 1.540000E-01 1.056000E-01 2.740130E-03 990 75 1.560000E-01 1.021500E-01 2.897320E-03 990 76 1.580000E-01 9.410800E-02 3.143370E-03 990 77 1.600000E-01 9.996000E-02 2.974610E-03 990 78 1.620000E-01 8.663900E-02 2.857540E-03 990 79 1.640000E-01 8.437700E-02 2.556030E-03 990 80 1.660000E-01 8.481900E-02 2.361090E-03 990 81 1.680000E-01 7.909700E-02 2.378690E-03 990 82 1.700000E-01 7.843200E-02 2.201370E-03 990 83 1.720000E-01 7.935800E-02 1.906900E-03 990 84 1.740000E-01 7.656800E-02 1.807490E-03 990 85 1.760000E-01 7.422600E-02 1.886570E-03 990 86 1.780000E-01 7.005800E-02 1.569990E-03 990 87 1.800000E-01 6.729300E-02 1.354270E-03 990 88 1.820000E-01 6.454100E-02 1.001830E-03 990 89 1.840000E-01 6.406100E-02 9.106440E-04 990 90 1.860000E-01 6.083000E-02 9.699580E-04 990 91 1.880000E-01 6.005000E-02 1.078110E-03 990 92 1.900000E-01 6.071000E-02 1.133220E-03 990 93 1.920000E-01 5.804100E-02 9.497300E-04 990 94 1.940000E-01 5.787200E-02 1.037690E-03 990 95 1.960000E-01 5.754300E-02 9.258630E-04 990 96 1.980000E-01 5.591500E-02 1.068720E-03 990 97 2.000000E-01 5.526000E-02 1.143170E-03 990 98 2.020000E-01 5.130500E-02 1.275020E-03 990 99 2.040000E-01 5.442800E-02 1.219280E-03 990 100 2.060000E-01 5.466600E-02 1.241090E-03 990 101 2.080000E-01 5.098300E-02 1.257040E-03 990 102 2.100000E-01 5.072900E-02 1.186780E-03 990 103 2.120000E-01 5.232700E-02 1.114360E-03 990 104 2.140000E-01 5.018300E-02 1.157490E-03 990 105 2.160000E-01 5.385200E-02 1.088060E-03 990 106 2.180000E-01 5.056000E-02 1.105970E-03 990 107 2.200000E-01 4.946100E-02 1.063360E-03 990 108 2.220000E-01 5.068000E-02 1.206500E-03 990 109 2.240000E-01 5.189800E-02 1.279110E-03 990 110 2.260000E-01 5.138800E-02 1.206730E-03 990 111 2.280000E-01 4.910100E-02 1.294380E-03 990 112 2.300000E-01 5.069200E-02 1.352770E-03 990 113 2.320000E-01 5.189100E-02 1.524620E-03 990 114 2.340000E-01 4.946200E-02 1.522170E-03 990 115 2.360000E-01 4.715800E-02 1.668770E-03 990 116 2.380000E-01 5.178800E-02 1.693600E-03 990 117 2.400000E-01 5.352400E-02 1.784530E-03 990 118 2.420000E-01 5.175200E-02 1.877530E-03 990 119 2.440000E-01 5.264100E-02 1.925740E-03 990 120 2.460000E-01 5.002300E-02 1.895840E-03 990 121 2.480000E-01 4.979800E-02 1.817200E-03 990 122 2.500000E-01 4.680100E-02 1.772910E-03 990 123 2.520000E-01 4.687300E-02 1.732580E-03 990 124 2.540000E-01 4.765400E-02 1.572830E-03 990 125 2.560000E-01 4.954000E-02 1.561850E-03 990 126 2.580000E-01 4.624000E-02 1.521680E-03 990 127 2.600000E-01 4.877700E-02 1.444100E-03 990 128 2.620000E-01 5.075300E-02 1.505980E-03 990 129 2.640000E-01 4.973600E-02 1.461850E-03 990 130 2.660000E-01 5.154400E-02 1.519990E-03 990 131 2.680000E-01 4.925600E-02 1.460560E-03 990 132 2.700000E-01 5.189900E-02 1.525190E-03 990 133 2.720000E-01 5.138600E-02 1.465690E-03 990 134 2.740000E-01 5.181100E-02 1.340880E-03 990 135 2.760000E-01 4.888800E-02 1.354610E-03 990 136 2.780000E-01 4.540600E-02 1.331590E-03 990 137 2.800000E-01 4.972300E-02 1.319550E-03 990 138 2.820000E-01 4.852100E-02 1.209620E-03 990 139 2.840000E-01 4.974700E-02 1.262480E-03 990 140 2.860000E-01 4.912400E-02 1.136070E-03 990 141 2.880000E-01 4.748200E-02 1.049220E-03 990 142 2.900000E-01 4.676100E-02 9.119070E-04 990 143 2.920000E-01 4.864700E-02 7.454600E-04 990 144 2.940000E-01 4.765300E-02 6.670360E-04 990 145 2.960000E-01 4.676200E-02 6.410040E-04 990 146 2.980000E-01 4.523300E-02 6.502420E-04 990 147 3.000000E-01 4.588100E-02 6.569620E-04 990 148 3.020000E-01 4.379800E-02 5.484530E-04 990 149 3.040000E-01 4.411900E-02 7.051960E-04 990 150 3.060000E-01 4.431000E-02 6.913400E-04 990 151 3.080000E-01 4.379600E-02 6.862080E-04 990 152 3.100000E-01 4.381200E-02 6.927780E-04 990 153 3.120000E-01 4.169500E-02 7.140290E-04 990 154 3.140000E-01 4.168600E-02 7.529390E-04 990 155 3.160000E-01 4.502200E-02 8.124870E-04 990 156 3.180000E-01 4.140700E-02 8.956520E-04 990 157 3.200000E-01 4.014400E-02 1.005410E-03 990 158 3.220000E-01 4.129800E-02 1.144740E-03 990 159 3.240000E-01 4.032300E-02 1.316630E-03 990 160 3.260000E-01 3.895800E-02 1.524040E-03 990 161 3.280000E-01 4.291300E-02 1.769960E-03 990 #