{
  "code": "SASDXY5",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Phosphorylation toggles the SARS-CoV-2 nucleocapsid protein between two membrane-associated condensate states.",
    "publication": {
      "title": "Phosphorylation toggles the SARS-CoV-2 nucleocapsid protein between two membrane-associated condensate states.",
      "author_list": "Favetta B, Wang H, Cubuk J, Singh A, Barai M, Ramirez C, Zheng H, Gormley AJ, Murthy NS, Dignon G, Soranno A, Shi Z, Schuster BS",
      "journal": "Nat Commun",
      "doi": "10.1038/s41467-025-62922-4",
      "pmid": "40858555",
      "published_date": "2025 Aug 26"
    },
    "status": "released",
    "submitted_date": "2025-07-03",
    "released_date": "2025-08-19"
  },
  "pddf_data": null,
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXY5.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXY5_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXY5_kratky_img.png",
  "pddf_plot": null,
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXY5_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXY5.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Duel detector",
        "name": "Pilatus3 S 1M, Pilatus3 900 K",
        "resolution": null
      },
      "name": "National Synchrotron Light Source II (NSLS-II)",
      "city": "Upton, NY",
      "country": "USA",
      "beamline_name": "16-ID (LiX)",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": true,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Nucleoprotein",
          "short_name": null,
          "sequence": "MHHHHHHENLYFQGSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA",
          "organism": "Severe acute respiratory syndrome coronavirus 2",
          "uniprot_code": "P0DTC9",
          "uniprot_range_first": 2,
          "uniprot_range_last": 419,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHG\nKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAG\nLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGS\nQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQ\nQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH\nWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAY\nKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA",
          "mw": 47.3,
          "total_mw": 94.6,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "The protein construct contains an additional 14 non-native amino acids at the N-terminus including a polyhistidine tag (MHHHHHHENLYFQG).\r\nN-terminal His6xtag+tev cleavage site"
        }
      ],
      "buffer": {
        "name": "20 mM Tris, 150 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "SARS-CoV-2 Nucleocapsid protein 1 mg/mL",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "Rutgers University",
            "webpage": null
          }
        ],
        "contributor_name": "Bruna",
        "contributor_surname": "Favetta",
        "orcid": "https://orcid.org/0000-0002-3613-1665"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2023-07-18",
    "storage_temperature": 4.0,
    "cell_temperature": 25.0,
    "exposure_time": 0.5,
    "number_of_frames": 10,
    "wavelength": 0.08189,
    "sample_detector_distance": 3.56,
    "concentration_min": null,
    "concentration_max": 1.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.05,
    "s_max": 2.5,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "BioXTAS RAW",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of SARS-CoV-2 Nucleocapsid protein in 20 mM Tris, 150 mM NaCl, pH 7.5 were collected on the 16-ID (LiX) beam line at the National Synchrotron Light Source II (NSLS-II) storage ring (Upton, NY, USA) of λ = 0.08189 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). SAXS data was collected over a s range of 0.05 - 31.3 nm-1 and analyzed within a range of 0.05 - 2.55 nm-1. Sample to detector distance for small angles was 3.560 m and 0.317 m for wide angles using Pilatus3X 1M and Pilatus3X 900k detectors. One solute concentration of 1.0 mg/ml was measured at 25°C. 10 successive 0.500 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 94.6,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 3.46,
  "pddf_i0_error": 0.03,
  "guinier_i0": 3.39467,
  "guinier_i0_error": null,
  "pddf_rg": 5.8,
  "pddf_rg_error": 0.1,
  "guinier_rg": 5.555,
  "guinier_rg_error": 0.066,
  "pddf_dmax": 18.8,
  "pddf_dmax_error": 0.1,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 3,
  "guinier_point_last": 20,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDXY5_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2025-09-01T15:11:14.619156+02:00",
  "bragg_peak": []
}