{ "code": "SASDFZ5", "status": "Published", "type_of_curve": "Single concentration", "angular_unit": "1/A", "project": { "title": "Nucleoid remodeling during environmental adaptation is regulated by HU-dependent DNA bundling.", "publication": { "title": "Nucleoid remodeling during environmental adaptation is regulated by HU-dependent DNA bundling.", "author_list": "Remesh SG, Verma SC, Chen JH, Ekman AA, Larabell CA, Adhya S, Hammel M", "journal": "Nat Commun", "doi": "10.1038/s41467-020-16724-5", "pmid": "32518228", "published_date": "2020 Jun 9" }, "status": "released", "submitted_date": "2019-04-26", "released_date": "2020-04-21" }, "pddf_data": null, "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDFZ5.dat", "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFZ5_dat_img.png", "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFZ5_kratky_img.png", "pddf_plot": null, "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFZ5_guinier_img.png", "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFZ5.sascif", "experiment": { "instrument": { "detector": { "type": null, "name": "Pilatus3 X 2M", "resolution": 172.0 }, "name": "Advanced Light Source (ALS)", "city": "Berkeley, CA", "country": "USA", "beamline_name": "12.3.1 (SIBYLS)", "beam_geometry": "", "type_of_source": "X-ray synchrotron", "point_source": null, "line_collimation": null, "sample_path_length": null, "line_collimation_slitlength": null, "line_collimation_integrationwidth": null, "xray_energy": null, "beam_profile_ah": null, "beam_profile_al": null }, "sample": { "molecule": [ { "long_name": "80bp_DNA Forward", "short_name": null, "sequence": "AATGAGGTAACAACGAAAGCAGATGATAGCTGCTTATCAATTTGTTGCAAACAAGTAGCCGCGCCCAATGAGGTAACAAT", "organism": "Escherichia coli", "uniprot_code": null, "uniprot_range_first": null, "uniprot_range_last": null, "oligomerization": "monomer", "molecular_type": "DNA", "uniprot_sequence": null, "mw": 24.849, "total_mw": 24.849, "number_molecules": 1, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null }, { "long_name": "80bp_DNA Reverse", "short_name": null, "sequence": "TTACTCCATTGTTGCTTTCGTCTACTATCGACGAATAGTTAAACAACGTTTGTTCATCGGCGCGGGTTACTCCATTGTTA", "organism": "Escherichia coli", "uniprot_code": null, "uniprot_range_first": null, "uniprot_range_last": null, "oligomerization": "monomer", "molecular_type": "DNA", "uniprot_sequence": null, "mw": 24.612, "total_mw": 24.612, "number_molecules": 1, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null }, { "long_name": "DNA-binding protein HU-alpha", "short_name": null, "sequence": "MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK", "organism": "Escherichia coli", "uniprot_code": "P0ACF0", "uniprot_range_first": 1, "uniprot_range_last": 90, "oligomerization": "unknown", "molecular_type": "protein", "uniprot_sequence": "MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTG\nRNPQTGKEIKIAAANVPAFVSGKALKDAVK", "mw": 9.535, "total_mw": 9.535, "number_molecules": 0, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": null } ], "buffer": { "name": "10 mM Bis-Tris, 150 mM NaCl", "concentration_unit": null, "comment": null, "additive": null, "concentration": null, "pka": null, "ph": 5.5, "deuteration": null }, "purity_method": null, "name": "DNA-binding protein HU-alpha bound to 80 base-pair DNA at pH 5.5 with 150 mM NaCl", "ext_coefficient": null, "contrast": null, "specific_vol": null, "dry_vol": null, "absorbption": null, "deuteration": null, "mixture": null }, "contributor": [ { "affiliation": [ { "short_name": "UCSF", "address": "San Francisco, CA, USA", "full_name": "University of California, San Francisco (UCSF)", "webpage": "https://www.ucsf.edu/" } ], "contributor_name": "Soumya", "contributor_surname": "G Remesh", "orcid": "" } ], "concentration_method": null, "concentration_unit": null, "date": "2018-05-27", "storage_temperature": null, "cell_temperature": 10.0, "exposure_time": 3.0, "number_of_frames": 300, "wavelength": 0.103, "sample_detector_distance": 1.5, "concentration_min": null, "concentration_max": null, "sample_volume": null, "flow_rate": null, "s_min": 0.092, "s_max": 3.503, "total_exposure_time": null, "seccolumn": null }, "fits": [], "estimated_volume_method": null, "pddf_software": null, "pddf_software_version": null, "i0_calibration_standard": null, "description": "SAXS profile corresponds to a protein-DNA complex between bacterial nucleoid associated protein HUalpha and 80bp DNA. Under these conditions, the complex forms lamellar structures visible as Bragg Diffraction peaks.", "experiment_description": "Synchrotron SAXS data from solutions of DNA-binding protein HU-alpha bound to 80 base-pair DNA in 10 mM Bis-Tris, 150 mM NaCl, pH 5.5 were collected on the 12.3.1 (SIBYLS) beam line at the Advanced Light Source (ALS) storage ring (Berkeley, CA, USA) using a Pilatus3 X 2M detector at a sample-detector distance of 1.5 m and at a wavelength of λ = 0.103 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). 300 successive 3 second frames were collected at 10°C. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.", "tags": [], "intensity_unit": "arbitrary", "experimental_mw": 300.0, "experimental_mw_error": null, "guinier_i0_mw": null, "guinier_i0_mw_error": null, "porod_mw": null, "porod_mw_error": null, "pddf_i0": null, "pddf_i0_error": null, "guinier_i0": null, "guinier_i0_error": null, "pddf_rg": 2.0, "pddf_rg_error": null, "guinier_rg": null, "guinier_rg_error": null, "pddf_dmax": null, "pddf_dmax_error": null, "porod_volume": null, "porod_volume_error": null, "estimated_volume": null, "estimated_volume_error": null, "guinier_point_first": null, "guinier_point_last": null, "pddf_point_first": null, "pddf_point_last": null, "i0_calibration_standard_data": null, "intensities_log_log_plot": "SASDFZ5_datloglog_img.png", "symmetry": null, "last_modified": "2020-06-22T11:01:30.790520+02:00", "bragg_peak": [] }