{ "code": "SASDWZ6", "status": "Published", "type_of_curve": "Single concentration", "angular_unit": "1/nm", "project": { "title": "The extracellular domain of SaNSrFP binds bacitracin and allows the identification of new members of the BceAB transporter family", "publication": { "title": "The extracellular domain of SaNSrFP binds bacitracin and allows the identification of new members of the BceAB transporter family", "author_list": "Mammen C, Gottstein J, Cea P, Tantsur K, Reiners J, Bonus M, Gohlke H, Smits S", "journal": "Frontiers in Microbiology", "doi": "10.3389/fmicb.2025.1662803", "pmid": null, "published_date": "2025 Sep 17" }, "status": "released", "submitted_date": "2025-02-04", "released_date": "2025-09-01" }, "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDWZ6.out", "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDWZ6.dat", "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWZ6_dat_img.png", "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWZ6_kratky_img.png", "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDWZ6_pofr_img.png", "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWZ6_guinier_img.png", "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWZ6.sascif", "experiment": { "instrument": { "detector": { "type": null, "name": "Pilatus3 2M", "resolution": 0.172 }, "name": "ESRF", "city": "Grenoble", "country": "France", "beamline_name": "BM29", "beam_geometry": "point", "type_of_source": "X-ray synchrotron", "point_source": null, "line_collimation": null, "sample_path_length": null, "line_collimation_slitlength": null, "line_collimation_integrationwidth": null, "xray_energy": null, "beam_profile_ah": null, "beam_profile_al": null }, "sample": { "molecule": [ { "long_name": "ABC transporter, permease protein, extracellular domain", "short_name": "SaNsrP ECD", "sequence": "G S H M S T G L F P K S V S L S I D N S K G D A K N I F E E K I L K K L G K S S K E A I T Y N Q T M I S M P V S Q S S E L N I T S K N V K H V D I T K T G F M Y L I T Q N D F R R L G H Q L P K L K D N Q V A Y F V Q K G D S R L K K I N L L G N K F D V V K N L K E A Y V P E T T N T Y N P G L I I F A N N K Q I D N I R K A Y L P Y T K N I N T F P K T F K A Y L D L N S Q E I N S I S K N D I I E V D G K Y V G N I S T", "organism": "Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)", "uniprot_code": "Q8DZX0", "uniprot_range_first": 311, "uniprot_range_last": 412, "oligomerization": "monomer", "molecular_type": "protein", "uniprot_sequence": "MFYLKIAWHNLKHSIDQYIPFLLASLLLYSLTCSTLLILMSAVGRDMGTAATVLFLGVIV\nLSIFAVVMEHYSYNILMKQRSSEFGLYNILGMNKRQVARVASLELFIIYIFLISIGSLFS\nAFFAKFIYLIFVNIINYHALNLSLSLWPFIICIVIFTGIFLTLEVPVIRHVHLSSPLSLF\nRKKQQGEKEPKGNLILAILALVAIAIAYTMALTSGKAPALAVIYRFFFAVLLVIAGTYLF\nYISFMTWYLKRLRQNKHYYYKSEHFVSTSQMIFRMKQNAVGLASITLLAVMALVTIATTV\nSLYSNTQNVVTGLFPKSVSLSIDNSKGDAKNIFEEKILKKLGKSSKEAITYNQTMISMPV\nSQSSELNITSKNVKHVDITKTGFMYLITQNDFRRLGHQLPKLKDNQVAYFVQKGDSRLKK\nINLLGNKFDVVKNLKEAYVPETTNTYNPGLIIFANNKQIDNIRKAYLPYTKNINTFPKTF\nKAYLDLNSQEINSISKNDIIEVDGKYVGNISTKQSFLKEGYQMFGGLLFTGFLLGISFLL\nGIALIVYYKQYSEGHEDKRSYRILQEVGMSKKLVKRTINSQIMIFFFQPLVVAVIHFGVA\nIPMLKQMLLVFGVLNSTIVYVVSGLTVLAISIIYFIIYRITSRTYYHIIER", "mw": 23.377, "total_mw": 23.377, "number_molecules": 1, "complex_state": false, "deuteration": null, "molecule_source": "biological", "molecule_description": "extracellular domain (ECD) from the ABC transporter permease protein" } ], "buffer": { "name": "25 mM MES, 500 mM NaCl", "concentration_unit": null, "comment": null, "additive": null, "concentration": null, "pka": null, "ph": 6.0, "deuteration": null }, "purity_method": null, "name": "ABC transporter permease protein extracellular domain from S.agalactiae (SaNsrP ECD)", "ext_coefficient": null, "contrast": null, "specific_vol": null, "dry_vol": null, "absorbption": null, "deuteration": null, "mixture": null }, "contributor": [ { "affiliation": [ { "short_name": null, "address": "Düsseldorf, Germany", "full_name": "Heinrich Heine University Düsseldorf", "webpage": "https://www.uni-duesseldorf.de" } ], "contributor_name": "Jens", "contributor_surname": "Reiners", "orcid": "" } ], "concentration_method": null, "concentration_unit": null, "date": "2020-12-03", "storage_temperature": 10.0, "cell_temperature": 10.0, "exposure_time": 1.0, "number_of_frames": 10, "wavelength": 0.099, "sample_detector_distance": 2.813, "concentration_min": null, "concentration_max": 1.65, "sample_volume": null, "flow_rate": null, "s_min": 0.134, "s_max": 4.187, "total_exposure_time": null, "seccolumn": null }, "fits": [], "estimated_volume_method": null, "pddf_software": "ATSAS GNOM", "pddf_software_version": "5.0", "i0_calibration_standard": null, "description": null, "experiment_description": null, "tags": [], "intensity_unit": "arbitrary", "experimental_mw": 24.92, "experimental_mw_error": null, "guinier_i0_mw": 22.94, "guinier_i0_mw_error": null, "porod_mw": 23.0, "porod_mw_error": null, "pddf_i0": 23.01, "pddf_i0_error": 0.06, "guinier_i0": 22.9415, "guinier_i0_error": null, "pddf_rg": 2.496, "pddf_rg_error": 0.01, "guinier_rg": 2.43, "guinier_rg_error": 0.06, "pddf_dmax": 9.0, "pddf_dmax_error": null, "porod_volume": 50.17, "porod_volume_error": null, "estimated_volume": null, "estimated_volume_error": null, "guinier_point_first": 1, "guinier_point_last": 77, "pddf_point_first": null, "pddf_point_last": null, "i0_calibration_standard_data": null, "intensities_log_log_plot": "SASDWZ6_datloglog_img.png", "symmetry": null, "last_modified": "2025-09-17T10:18:55.278059+02:00", "bragg_peak": [] }