← Back to search

11kr

FabG1 targeting prion oligomers and fibrils

Method: X-RAY DIFFRACTION D_max: 77.0 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	11kr
deposition_date	2026-03-02
title	FabG1 targeting prion oligomers and fibrils
keywords	Antibody targeting prion oligomers and fibrils., PROTEIN BINDING; PROTEIN BINDING
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	24.82 Å
rg_electron	23.91 Å
i0	37676500.00
molecular_weight	46920.0 kDa
excluded_volume	58338 Å³
envelope_volume	70690 Å³
shell_volume	24795 Å³
envelope_diameter	79.5 Å
shell_rg	30.75 Å
envelope_rg	23.68 Å
shape_rg	23.89 Å
total_rg	24.73 Å
total_atoms	3295
n_residues	434
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	77.0 Å
rg_real	24.78 Å
rg_real_error	0.48 Å
i0_real	3.7680e+07
i0_real_error	4.6110e+05
rg_reciprocal	24.79 Å
i0_reciprocal	37680000.0000
total_estimate	0.9104
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	2
r_peak_primary	29.3 Å
skewness	0.264
kurtosis	-0.497
angular_range	— – 0.3200 Å⁻¹
current_alpha	0.0000
highest_alpha	9393000.0000
n_real_points	64
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.960; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.992; Smooth: 0.958

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (6)

Entity 1 polymer

description	FabG1 heavy chain
formula_weight	25103.1 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	J
atom_count	3370

QVQLQQSGPHLVRPGASVKISCKASGYSFTSYWMHWVKQRPGQGLEWIGMIDPSDSETKLNQQFKDKATLTVDTSSSTAYMQLTSPTSEDSVVYYCARGKMGGRFYFDYLGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHHHHHH

Source

organism	Mus musculus
ncbi_taxonomy_id	10090
host_organism	Homo sapiens

Entity 2 polymer

description	FabG1 light chain
formula_weight	23645.3 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	K

DIVMTQSHKFMSTSVGDRVSITCKASQDVGTAVVWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGFGTDFTLTISNVQSEDLADYFCQQFSSYPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHRVYACEVTHQGLSSPVTKSFNRGEC

Source

organism	Mus musculus
ncbi_taxonomy_id	10090
host_organism	Homo sapiens

Entity 3 non-polymer

description	ACETATE ION
formula_weight	59.0 kDa
src_method	syn
entity_count	1

Entity 4 non-polymer

description	ZINC ION
formula_weight	65.4 kDa
src_method	syn
entity_count	2

Entity 5 non-polymer

description	SODIUM ION
formula_weight	23.0 kDa
src_method	syn
entity_count	3

Entity 6 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	63

▶

6. Citations (1)

▶

length_a	71.754 Å
length_b	71.754 Å
length_c	89.505 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	120.00 °
z_pdb	3

space_group	P 31
int_tables_number	144
crystal_system	—

resolution	2.480 Å
resolution_low	36.320 Å
r_factor	0.1888
r_work	0.1857
r_free	0.2426

fit	/app/data/saxs_computation/1k/11kr/11kr.fit
pddf	/app/data/pr_computation/1k/11kr/11kr.pr.out
profile	/app/data/saxs_computation/1k/11kr/11kr.dat

FabG1 targeting prion oligomers and fibrils

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (6)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 non-polymer

Entity 4 non-polymer

Entity 5 non-polymer

Entity 6 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)