SAXSdb — 1b0n

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PROTEIN (SINR PROTEIN)

Bacillus subtilis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	PROTEIN (SINI PROTEIN) × 1 （P23308） ZINC ION × 5 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	PROTEIN (SINI PROTEIN) × 2 （P23308） ZINC ION × 10 water × 4	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	PROTEIN (SINI PROTEIN) × 2 （P23308） ZINC ION × 10 water × 4	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 4	PROTEIN (SINI PROTEIN) × 2 （P23308） ZINC ION × 10 water × 4	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 4	PROTEIN (SINI PROTEIN) × 2 （P23308） ZINC ION × 10 water × 4	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 4	PROTEIN (SINI PROTEIN) × 2 （P23308） ZINC ION × 10 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SINR_BACSU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–111； UniProt 1–111

PROTEIN (SINI PROTEIN)

Bacillus subtilis

UniProt P23308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	PROTEIN (SINR PROTEIN) × 1 （P06533） ZINC ION × 5 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	PROTEIN (SINR PROTEIN) × 2 （P06533） ZINC ION × 10 water × 4	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	PROTEIN (SINR PROTEIN) × 2 （P06533） ZINC ION × 10 water × 4	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 4	PROTEIN (SINR PROTEIN) × 2 （P06533） ZINC ION × 10 water × 4	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 4	PROTEIN (SINR PROTEIN) × 2 （P06533） ZINC ION × 10 water × 4	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 4	PROTEIN (SINR PROTEIN) × 2 （P06533） ZINC ION × 10 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SINI_BACSU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–57； UniProt 1–57

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1b0n
Deposition date deposition_date	1998-11-11
Structure title title	SINR PROTEIN/SINI PROTEIN COMPLEX
Keywords keywords	TRANSCRIPTION REGULATOR, ANTAGONIST, SPORULATION; TRANSCRIPTION REGULATOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1b0n__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1b0n__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1b0n__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	17.10 Å
Rg (electron density)	16.42 Å
Total Rg	17.22 Å
Atom count	1113
Residues	134
Excluded volume	19975 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1b0n__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1b0n__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1b0n__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1b0n__assembly_4__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`1b0n__assembly_5__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`1b0n__assembly_6__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	PROTEIN (SINR PROTEIN)
Molecular weight formula_weight	13009.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1234

MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHTLLDEKHETEYDGQLDSEWEKLVRDAMTSGVSKKQFREFLDYQKWRKSQKEE

Source Source

Source organism organism	Bacillus subtilis
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	PROTEIN (SINI PROTEIN)
Molecular weight formula_weight	6612.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Source Source

Source organism organism	Bacillus subtilis
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	117

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1b0na1
Class class	a — All alpha proteins
Fold Fold fold	a.34 — Dimerisation interlock
Superfamily Superfamily superfamily	a.34.1 — SinR repressor dimerisation domain-like
Family Family family	a.34.1.1 — SinR repressor dimerisation domain-like

Domain ID domain_id	d1b0na2
Class class	a — All alpha proteins
Fold Fold fold	a.35 — lambda repressor-like DNA-binding domains
Superfamily Superfamily superfamily	a.35.1 — lambda repressor-like DNA-binding domains
Family Family family	a.35.1.3 — SinR domain-like

Domain ID domain_id	d1b0nb_
Class class	a — All alpha proteins
Fold Fold fold	a.34 — Dimerisation interlock
Superfamily Superfamily superfamily	a.34.1 — SinR repressor dimerisation domain-like
Family Family family	a.34.1.1 — SinR repressor dimerisation domain-like

CATH v4.4 (1 domains)

Domain ID domain_id	1b0nA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	260 — 434 Repressor (Amino-terminal Domain)
Homologous superfamily homologous superfamily	40 — lambda repressor-like DNA-binding domains

▶

Unit-cell length a length_a	60.900 Å
Unit-cell length b length_b	60.900 Å
Unit-cell length c length_c	87.740 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 31 2 1
Space-group number int_tables_number	152
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	—
R_work r_work	0.1990
R_free r_free	0.2450

SINR PROTEIN/SINI PROTEIN COMPLEX

1. Protein Identity and Related Structures Protein Identity & Related Structures

PROTEIN (SINR PROTEIN)

State in the Current Structure

Other States of the Same Protein in the Database

PROTEIN (SINI PROTEIN)

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1b0n__assembly_1__model_1

1b0n__assembly_1__model_1 | I(q)

1b0n__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (3 domains)

CATH v4.4 (1 domains)

7. Citations (1)

SINR PROTEIN/SINI PROTEIN COMPLEX

1. Protein Identity and Related Structures Protein Identity & Related Structures

PROTEIN (SINR PROTEIN)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PROTEIN (SINI PROTEIN)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1b0n__assembly_1__model_1

1b0n__assembly_1__model_1 | I(q)

1b0n__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (3 domains)

CATH v4.4 (1 domains)

7. Citations (1)