SAXSdb — 1bxe

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PROTEIN (RIBOSOMAL PROTEIN L22)

Thermus thermophilus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 1–113	Mutation：MET1MSE, MET64MSE Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions：pH 7；pH 7	Resolution 1.90 Å R-free 0.219

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1BXE	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1I4J CRYSTAL STRUCTURE OF L22 RIBOSOMAL PROTEIN MUTANT Deposited 2001-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–113（113 aa） Chain B 1–113（113 aa）	Mutation：DEL(82-84) Mutation：DEL(82-84)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；1.9M Sodium chloride, 3% ethanol, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 1.80 Å R-free 0.255
4V42 Crystal structure of the ribosome at 5.5 A resolution. Deposited 2001-03-30	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 42 PDB declaration: 49-meric	Chain BS 1–113（113 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 5.50 Å
4V4P Crystal structure of 70S ribosome with thrS operator and tRNAs. Deposited 2005-01-19	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 58-meric	Chain AS 1–113（113 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；MPD, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 5.50 Å R-free 0.356
4V4R Crystal structure of the whole ribosomal complex. Deposited 2005-09-30	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 56-meric	Chain BW 1–113（113 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.7；277 K；PEG20k, MES buffer, magnesium acetate, potassium chloride, ammonium chloride, pH 6.7, VAPOR DIFFUSION, temperature 277K	Resolution 5.90 Å R-free 0.371
4V4S Crystal structure of the whole ribosomal complex. Deposited 2005-10-12	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 56-meric	Chain BW 1–113（113 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.7；277 K；PEG20k, MES buffer, magnesium acetate, potassium chloride, ammonium chloride, pH 6.7, VAPOR DIFFUSION, temperature 277K	Resolution 6.76 Å R-free 0.356
4V4T Crystal structure of the whole ribosomal complex with a stop codon in the A-site. Deposited 2005-10-12	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 49 PDB declaration: 55-meric	Chain BW 1–113（113 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.7；277 K；PEG20k, MES buffer, magnesium acetate, potassium chloride, ammonium chloride, pH 6.7, VAPOR DIFFUSION, temperature 277K	Resolution 6.46 Å R-free 0.361
4V4X Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. Deposited 2006-06-27	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 55-meric	Chain BV 1–113（113 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；MPD, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 5.00 Å R-free 0.323
4V4Y Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. Deposited 2006-06-27	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 57-meric	Chain BV 1–113（113 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；MPD, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 5.50 Å R-free 0.326
4V4Z 70S Thermus thermophilous ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. Deposited 2006-06-27	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 56-meric	Chain BV 1–113（113 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；MPD, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 4.51 Å R-free 0.345
4WR6 Complex of 70S ribosome with tRNA-Tyr and mRNA with A-A mismatch in the first position in the A-site. Deposited 2014-10-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 47 PDB declaration: 54-MERIC	Chain E8 1–113（113 aa）	Not recorded	MG MAGNESIUM ION × 652 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；Tris-acetate, KSCN, PEG 550MME, PEG 20K	Resolution 3.05 Å R-free 0.249
4WR6 Complex of 70S ribosome with tRNA-Tyr and mRNA with A-A mismatch in the first position in the A-site. Deposited 2014-10-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 47 PDB declaration: 54-MERIC	Chain A5 1–113（113 aa）	Not recorded	MG MAGNESIUM ION × 508 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；Tris-acetate, KSCN, PEG 550MME, PEG 20K	Resolution 3.05 Å R-free 0.249
4WU1 Complex of 70S ribosome with tRNA-Tyr and mRNA with G-U mismatch in the second position in the P-site Deposited 2014-10-30	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 48 PDB declaration: 54-meric	Chain E8 1–113（113 aa）	Not recorded	MG MAGNESIUM ION × 708 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；Tris-acetate, KSCN, PEG 550MME, PEG 20K	Resolution 3.20 Å R-free 0.238
4WU1 Complex of 70S ribosome with tRNA-Tyr and mRNA with G-U mismatch in the second position in the P-site Deposited 2014-10-30	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 48 PDB declaration: 54-meric	Chain A5 1–113（113 aa）	Not recorded	MG MAGNESIUM ION × 673 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；Tris-acetate, KSCN, PEG 550MME, PEG 20K	Resolution 3.20 Å R-free 0.238
4WZD Complex of 70S ribosome with cognate tRNA-Tyr in the P-site Deposited 2014-11-19	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 49 PDB declaration: 55-meric	Chain E8 1–113（113 aa）	Not recorded	MG MAGNESIUM ION × 699 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；Tris-acetate, KSCN, PEG 550MME, PEG 20K	Resolution 3.10 Å R-free 0.193
4WZD Complex of 70S ribosome with cognate tRNA-Tyr in the P-site Deposited 2014-11-19	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 49 PDB declaration: 55-meric	Chain A5 1–113（113 aa）	Not recorded	MG MAGNESIUM ION × 646 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；Tris-acetate, KSCN, PEG 550MME, PEG 20K	Resolution 3.10 Å R-free 0.193
6C5L Conformation of methylated GGQ in the Peptidyl Transferase Center during translation termination (T. thermophilus) Deposited 2018-01-16	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 59-meric	Chain BW 1–113（113 aa）	Not recorded	MG MAGNESIUM ION × 218 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；292 K；5 mM HEPES, pH 7.5, 10 mM magnesium acetate, 50 mM potassium chloride, 10 mM ammonium chloride, 6 mM BME	Resolution 3.20 Å R-free 0.247
6C5L Conformation of methylated GGQ in the Peptidyl Transferase Center during translation termination (T. thermophilus) Deposited 2018-01-16	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 53 PDB declaration: 59-meric	Chain DW 1–113（113 aa）	Not recorded	MG MAGNESIUM ION × 256 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；292 K；5 mM HEPES, pH 7.5, 10 mM magnesium acetate, 50 mM potassium chloride, 10 mM ammonium chloride, 6 mM BME	Resolution 3.20 Å R-free 0.247
6CFJ Crystal structure of the Thermus thermophilus 70S ribosome in complex with histidyl-CAM and bound to mRNA and A-, P-, and E-site tRNAs at 2.8A resolution Deposited 2018-02-15	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 49 PDB declaration: 56-meric	Chain 1W 1–113（113 aa）	Not recorded	MG MAGNESIUM ION × 1492 K POTASSIUM ION × 2 EZG N-[(1R,2R)-1,3-dihydroxy-1-(4-nitrophenyl)propan-2-yl]-L-histidinamide × 1 ZN ZINC ION × 6 SF4 IRON/SULFUR CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.6；292 K；0.1-0.2 M Arginine-HCl, 0.1M Tris-HCl pH 7.6, 2.5% PEG-20K, 7-12% MPD, 0.5 mM BME	Resolution 2.80 Å R-free 0.269
6CFJ Crystal structure of the Thermus thermophilus 70S ribosome in complex with histidyl-CAM and bound to mRNA and A-, P-, and E-site tRNAs at 2.8A resolution Deposited 2018-02-15	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 49 PDB declaration: 56-meric	Chain 2W 1–113（113 aa）	Not recorded	MG MAGNESIUM ION × 1113 K POTASSIUM ION × 2 EZG N-[(1R,2R)-1,3-dihydroxy-1-(4-nitrophenyl)propan-2-yl]-L-histidinamide × 1 ZN ZINC ION × 6 SF4 IRON/SULFUR CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.6；292 K；0.1-0.2 M Arginine-HCl, 0.1M Tris-HCl pH 7.6, 2.5% PEG-20K, 7-12% MPD, 0.5 mM BME	Resolution 2.80 Å R-free 0.269
6CFK Crystal structure of the Thermus thermophilus 70S ribosome in complex with D-histidyl-CAM and bound to protein Y (YfiA) at 2.7A resolution Deposited 2018-02-15	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 53-meric	Chain 1W 1–113（113 aa）	Not recorded	MG MAGNESIUM ION × 1422 K POTASSIUM ION × 1 EZP N-[(1R,2R)-1,3-dihydroxy-1-(4-nitrophenyl)propan-2-yl]-D-histidinamide × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 4 ARG ARGININE × 2 ZN ZINC ION × 6 SF4 IRON/SULFUR CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.6；292 K；0.1-0.2 M Arginine-HCl, 0.1M Tris-HCl pH 7.6, 2.5% PEG-20K, 7-12% MPD, 0.5 mM BME	Resolution 2.70 Å R-free 0.253
6CFK Crystal structure of the Thermus thermophilus 70S ribosome in complex with D-histidyl-CAM and bound to protein Y (YfiA) at 2.7A resolution Deposited 2018-02-15	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 50 PDB declaration: 53-meric	Chain 2W 1–113（113 aa）	Not recorded	MG MAGNESIUM ION × 940 K POTASSIUM ION × 1 EZP N-[(1R,2R)-1,3-dihydroxy-1-(4-nitrophenyl)propan-2-yl]-D-histidinamide × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 3 ZN ZINC ION × 6 SF4 IRON/SULFUR CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.6；292 K；0.1-0.2 M Arginine-HCl, 0.1M Tris-HCl pH 7.6, 2.5% PEG-20K, 7-12% MPD, 0.5 mM BME	Resolution 2.70 Å R-free 0.253
6CFL Crystal structure of the Thermus thermophilus 70S ribosome in complex with lysyl-CAM and bound to protein Y (YfiA) at 2.6A resolution Deposited 2018-02-15	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 53-meric	Chain 1W 1–113（113 aa）	Not recorded	MG MAGNESIUM ION × 1474 K POTASSIUM ION × 1 EZM N-[(1R,2R)-1,3-dihydroxy-1-(4-nitrophenyl)propan-2-yl]-L-lysinamide × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 4 ARG ARGININE × 2 ZN ZINC ION × 6 SF4 IRON/SULFUR CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.6；292 K；0.1-0.2 M Arginine-HCl, 0.1M Tris-HCl pH 7.6, 2.5% PEG-20K, 7-12% MPD, 0.5 mM BME	Resolution 2.60 Å R-free 0.252
6CFL Crystal structure of the Thermus thermophilus 70S ribosome in complex with lysyl-CAM and bound to protein Y (YfiA) at 2.6A resolution Deposited 2018-02-15	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Heteromer；Protein × 50 PDB declaration: 53-meric	Chain 2W 1–113（113 aa）	Not recorded	MG MAGNESIUM ION × 955 K POTASSIUM ION × 1 EZM N-[(1R,2R)-1,3-dihydroxy-1-(4-nitrophenyl)propan-2-yl]-L-lysinamide × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 3 ZN ZINC ION × 6 SF4 IRON/SULFUR CLUSTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.6；292 K；0.1-0.2 M Arginine-HCl, 0.1M Tris-HCl pH 7.6, 2.5% PEG-20K, 7-12% MPD, 0.5 mM BME	Resolution 2.60 Å R-free 0.252

16 other PDB entries and 23 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RL22_THETH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–113； UniProt 1–113

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1bxe
Deposition date deposition_date	1998-10-02
Structure title title	RIBOSOMAL PROTEIN L22 FROM THERMUS THERMOPHILUS
Keywords keywords	RIBOSOMAL PROTEIN, PROTEIN SYNTHESIS, RNA BINDING, ANTIBIOTICS RESISTANCE, RNA BINDING PROTEIN; RNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	18.16 Å
Radius of gyration Rg (electron density) rg_electron	17.46 Å
Forward intensity I(0) i0	3282490.00
Molecular weight molecular_weight	12654.0 kDa
Excluded volume excluded_volume	15858 Å³
Envelope volume envelope_volume	19600 Å³
Hydration-shell volume shell_volume	10977 Å³
Envelope diameter envelope_diameter	70.3 Å
Shell Rg shell_rg	21.37 Å
Envelope Rg envelope_rg	18.77 Å
Shape Rg shape_rg	17.42 Å
Total Rg total_rg	18.34 Å
Total atoms total_atoms	879
Residues n_residues	108
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	71.1 Å
Rg (real space) rg_real	18.63 Å
Rg uncertainty (real space) rg_real_error	0.63 Å
I(0) (real space) i0_real	3.2820e+06
I(0) uncertainty (real space) i0_real_error	4.3740e+04
Rg (reciprocal space) rg_reciprocal	18.57 Å
I(0) (reciprocal space) i0_reciprocal	3282000.0000
Solution quality estimate total_estimate	0.7226
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	17.3 Å
Skewness Skewness skewness	0.897
Kurtosis Kurtosis kurtosis	0.593
Angular range angular_range	— – 0.4400 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	739300.0000
Real-space data points n_real_points	75
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.378; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.309; Smooth: 0.948

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	PROTEIN (RIBOSOMAL PROTEIN L22)
Molecular weight formula_weight	12901.8 kDa
Mutation mutation	MET1MSE, MET64MSE
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	948

MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGEKHGK

来源 Source

来源生物 organism	Thermus thermophilus
NCBI Class编号 ncbi_taxonomy_id	274
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	63

▼

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d1bxea_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.55 — Ribosomal protein L22
Superfamily Superfamily superfamily	d.55.1 — Ribosomal protein L22
Family Family family	d.55.1.1 — Ribosomal protein L22

CATH v4.4 (1 domains)

Domain ID domain_id	1bxeA00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	470 — Ribosomal Protein L22; Chain A
Homologous superfamily homologous superfamily	10 — Ribosomal protein L22/L17

▶

8. Citations (1)

▶

Unit-cell length a length_a	32.640 Å
Unit-cell length b length_b	65.930 Å
Unit-cell length c length_c	67.830 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	10.000 Å
R factor r_factor	0.1890
R_work r_work	0.1890
R_free r_free	0.2190

fit	/app/data/saxs_computation/bx/1bxe/1bxe.fit
pddf	/app/data/pr_computation/bx/1bxe/1bxe.pr.out
profile	/app/data/saxs_computation/bx/1bxe/1bxe.dat

RIBOSOMAL PROTEIN L22 FROM THERMUS THERMOPHILUS

1. Protein Identity and Related Structures Protein Identity & Related Structures

PROTEIN (RIBOSOMAL PROTEIN L22)

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction