SAXSdb — 1cpb

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CARBOXYPEPTIDASE B

Bos taurus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–82 Chain B； UniProt 90–306	Not recorded	No other associated polymer	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.80 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	CBPB1_BOVIN
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–82； UniProt 1–82 Author chain B； PDBConstruct 1–217； UniProt 90–306

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1cpb
Deposition date deposition_date	1976-06-23
Structure title title	STRUCTURE OF CARBOXYPEPTIDASE B AT 2.8 ANGSTROMS RESOLUTION
Keywords keywords	HYDROLASE (C-TERMINAL PEPTIDASE); HYDROLASE (C-TERMINAL PEPTIDASE)
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	17.78 Å
Radius of gyration Rg (electron density) rg_electron	16.80 Å
Forward intensity I(0) i0	18983400.00
Molecular weight molecular_weight	33826.0 kDa
Excluded volume excluded_volume	40950 Å³
Envelope volume envelope_volume	25130 Å³
Hydration-shell volume shell_volume	13527 Å³
Envelope diameter envelope_diameter	56.3 Å
Shell Rg shell_rg	21.09 Å
Envelope Rg envelope_rg	16.12 Å
Shape Rg shape_rg	16.97 Å
Total Rg total_rg	17.25 Å
Total atoms total_atoms	—
Residues n_residues	—
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	57.4 Å
Rg (real space) rg_real	17.64 Å
Rg uncertainty (real space) rg_real_error	0.20 Å
I(0) (real space) i0_real	1.8980e+07
I(0) uncertainty (real space) i0_real_error	2.0820e+05
Rg (reciprocal space) rg_reciprocal	17.66 Å
I(0) (reciprocal space) i0_reciprocal	18980000.0000
Solution quality estimate total_estimate	0.8087
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	23.2 Å
Skewness Skewness skewness	0.104
Kurtosis Kurtosis kurtosis	-0.415
Angular range angular_range	— – 0.4450 Å⁻¹
Current regularization parameter α current_alpha	0.0004
Highest regularization parameter α highest_alpha	2803000.0000
Real-space data points n_real_points	75
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.840; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.988; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	CARBOXYPEPTIDASE B
Molecular weight formula_weight	9353.4 kDa
EC 编号 ec_number	3.4.17.2
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	299

TTGHSYEKYNNWETIEAWTEQVASENPDLISRSAIGTTFLGNTIYLLKVGKPGSNKPAVFMDCGFHAREWISPAFCQWFVRE

来源 Source

来源生物 organism	Bos taurus
通用名 common_name	cattle
NCBI Class编号 ncbi_taxonomy_id	9913

Entity 2 Entity 2 polymer

Description description	CARBOXYPEPTIDASE B
Molecular weight formula_weight	24507.5 kDa
EC 编号 ec_number	3.4.17.2
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

EIHMTEFLDKLDFYVLPVVNIDGYIYTWTTNRMWRKTRSTRAGSSCTGTDLNRNFDAGWCSIGASNNPCSETYCGSAAESEKESKAVADFIRNHLSSIKAYLTIHSYSQMMLYPYSYDYKLPKNNVELNTLAKGAVKKLASLHGTTYSYGPGATTIYPASGGSDDWAYDQGIKYSFTFELRDKGRYGFVLPESQIQPTCEETMLAIKYVTSYVLEHL

来源 Source

来源生物 organism	Bos taurus
通用名 common_name	cattle
NCBI Class编号 ncbi_taxonomy_id	9913

▼

7. Fold Classification (SCOP + CATH) 1 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d1cpb.1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.56 — Phosphorylase/hydrolase-like
Superfamily Superfamily superfamily	c.56.5 — Zn-dependent exopeptidases
Family Family family	c.56.5.1 — Pancreatic carboxypeptidases

▶

8. Citations (4)

▶

Unit-cell length a length_a	54.940 Å
Unit-cell length b length_b	54.940 Å
Unit-cell length c length_c	104.600 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	3

Space group space_group	P 32
Space-group number int_tables_number	145
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

fit	/app/data/saxs_computation/cp/1cpb/1cpb.fit
pddf	/app/data/pr_computation/cp/1cpb/1cpb.pr.out
profile	/app/data/saxs_computation/cp/1cpb/1cpb.dat

STRUCTURE OF CARBOXYPEPTIDASE B AT 2.8 ANGSTROMS RESOLUTION

1. Protein Identity and Related Structures Protein Identity & Related Structures

CARBOXYPEPTIDASE B

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

7. Fold Classification (SCOP + CATH) 1 domains

SCOP 2.08 (1 domains)

8. Citations (4)

9. Files and Curves (10)

Files (7)

Curves (3)