SAXSdb — 1cpc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-PHYCOCYANIN (ALPHA SUBUNIT)

Fremyella diplosiphon

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–162	Not recorded	C-PHYCOCYANIN (BETA SUBUNIT) × 1 （P07119） CYC PHYCOCYANOBILIN × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.66 Å
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain K； UniProt 1–162	Not recorded	C-PHYCOCYANIN (BETA SUBUNIT) × 1 （P07119） CYC PHYCOCYANOBILIN × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.66 Å
3	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain A； UniProt 1–162 Chain K； UniProt 1–162	Not recorded	C-PHYCOCYANIN (BETA SUBUNIT) × 6 （P07119） CYC PHYCOCYANOBILIN × 18	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.66 Å
4	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 1–162	Not recorded	C-PHYCOCYANIN (BETA SUBUNIT) × 3 （P07119） CYC PHYCOCYANOBILIN × 9	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.66 Å
5	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain K； UniProt 1–162	Not recorded	C-PHYCOCYANIN (BETA SUBUNIT) × 3 （P07119） CYC PHYCOCYANOBILIN × 9	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.66 Å
6	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 1–162 Chain K； UniProt 1–162	Not recorded	C-PHYCOCYANIN (BETA SUBUNIT) × 2 （P07119） CYC PHYCOCYANOBILIN × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.66 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	PHA1_FREDI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–162； UniProt 1–162 Author chain K； PDBConstruct 1–162； UniProt 1–162

C-PHYCOCYANIN (BETA SUBUNIT)

Fremyella diplosiphon

UniProt P07119

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 1–172	Non-standard monomer：Yes (specific site not provided by mmCIF)	C-PHYCOCYANIN (ALPHA SUBUNIT) × 1 （P07122） CYC PHYCOCYANOBILIN × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.66 Å
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain L； UniProt 1–172	Non-standard monomer：Yes (specific site not provided by mmCIF)	C-PHYCOCYANIN (ALPHA SUBUNIT) × 1 （P07122） CYC PHYCOCYANOBILIN × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.66 Å
3	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain B； UniProt 1–172 Chain L； UniProt 1–172	Non-standard monomer：Yes (specific site not provided by mmCIF)	C-PHYCOCYANIN (ALPHA SUBUNIT) × 6 （P07122） CYC PHYCOCYANOBILIN × 18	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.66 Å
4	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain B； UniProt 1–172	Non-standard monomer：Yes (specific site not provided by mmCIF)	C-PHYCOCYANIN (ALPHA SUBUNIT) × 3 （P07122） CYC PHYCOCYANOBILIN × 9	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.66 Å
5	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain L； UniProt 1–172	Non-standard monomer：Yes (specific site not provided by mmCIF)	C-PHYCOCYANIN (ALPHA SUBUNIT) × 3 （P07122） CYC PHYCOCYANOBILIN × 9	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.66 Å
6	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain B； UniProt 1–172 Chain L； UniProt 1–172	Non-standard monomer：Yes (specific site not provided by mmCIF)	C-PHYCOCYANIN (ALPHA SUBUNIT) × 2 （P07122） CYC PHYCOCYANOBILIN × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.66 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	PHB1_FREDI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–172； UniProt 1–172 Author chain L； PDBConstruct 1–172； UniProt 1–172

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1cpc
Deposition date deposition_date	1990-10-11
Structure title title	ISOLATION, CRYSTALLIZATION, CRYSTAL STRUCTURE ANALYSIS AND REFINEMENT OF CONSTITUTIVE C-PHYCOCYANIN FROM THE CHROMATICALLY ADAPTING CYANOBACTERIUM FREMYELLA DIPLOSIPHON AT 1.66 ANGSTROMS RESOLUTION
Keywords keywords	LIGHT HARVESTING PROTEIN; LIGHT HARVESTING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	29.19 Å
Radius of gyration Rg (electron density) rg_electron	28.49 Å
Forward intensity I(0) i0	87458600.00
Molecular weight molecular_weight	73839.0 kDa
Excluded volume excluded_volume	92455 Å³
Envelope volume envelope_volume	111450 Å³
Hydration-shell volume shell_volume	33073 Å³
Envelope diameter envelope_diameter	105.1 Å
Shell Rg shell_rg	35.14 Å
Envelope Rg envelope_rg	28.51 Å
Shape Rg shape_rg	28.51 Å
Total Rg total_rg	29.03 Å
Total atoms total_atoms	5191
Residues n_residues	666
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	98.2 Å
Rg (real space) rg_real	29.18 Å
Rg uncertainty (real space) rg_real_error	0.60 Å
I(0) (real space) i0_real	8.7460e+07
I(0) uncertainty (real space) i0_real_error	1.2320e+06
Rg (reciprocal space) rg_reciprocal	29.19 Å
I(0) (reciprocal space) i0_reciprocal	87460000.0000
Solution quality estimate total_estimate	0.8898
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	34.5 Å
Skewness Skewness skewness	0.338
Kurtosis Kurtosis kurtosis	-0.314
Angular range angular_range	— – 0.2700 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	23800000.0000
Real-space data points n_real_points	55
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.858; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.993; Smooth: 0.995

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	C-PHYCOCYANIN (ALPHA SUBUNIT)
Molecular weight formula_weight	17243.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,K
Atom count atom_count	5434

MKTPLTEAVAAADSQGRFLSSTEIQTAFGRFRQASASLAAAKALTEKASSLASGAANAVYSKFPYTTSQNGPNFASTQTGKDKCVRDIGYYLRMVTYCLVVGGTGPLDDYLIGGIAEINRTFDLSPSWYVEALKYIKANHGLSGDPAVEANSYIDYAINALS

来源 Source

来源生物 organism	Fremyella diplosiphon
NCBI Class编号 ncbi_taxonomy_id	1197

Entity 2 Entity 2 polymer

Description description	C-PHYCOCYANIN (BETA SUBUNIT)
Molecular weight formula_weight	17950.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,L

MLDAFAKVVSQADARGEYLSGSQIDALSALVADGNKRMDVVNRITGNSSTIVANAARSLFAEQPQLIAPGGNAYTSRRMAACLRDMEIILRYVTYAIFAGDASVLDDRCLNGLKETYLALGTPGSSVAVGVQKMKDAALAIAGDTNGITRGDCASLMAEVASYFDKAASAVA

来源 Source

来源生物 organism	Fremyella diplosiphon
NCBI Class编号 ncbi_taxonomy_id	1197

Entity 3 Entity 3 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	243

▼

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1cpca_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.3 — Phycocyanin-like phycobilisome proteins

Domain ID domain_id	d1cpcb_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.3 — Phycocyanin-like phycobilisome proteins

Domain ID domain_id	d1cpck_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.3 — Phycocyanin-like phycobilisome proteins

Domain ID domain_id	d1cpcl_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.3 — Phycocyanin-like phycobilisome proteins

CATH v4.4 (4 domains)

Domain ID domain_id	1cpcA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	20 — Phycocyanins

Domain ID domain_id	1cpcB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	20 — Phycocyanins

Domain ID domain_id	1cpcK00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	20 — Phycocyanins

Domain ID domain_id	1cpcL00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	20 — Phycocyanins

▶

8. Citations (1)

▶

Unit-cell length a length_a	180.260 Å
Unit-cell length b length_b	180.260 Å
Unit-cell length c length_c	61.240 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	1.660 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	0.1810
R_free r_free	—

fit	/app/data/saxs_computation/cp/1cpc/1cpc.fit
pddf	/app/data/pr_computation/cp/1cpc/1cpc.pr.out
profile	/app/data/saxs_computation/cp/1cpc/1cpc.dat

ISOLATION, CRYSTALLIZATION, CRYSTAL STRUCTURE ANALYSIS AND REFINEMENT OF CONSTITUTIVE C-PHYCOCYANIN FROM THE CHROMATICALLY ADAPTING CYANOBACTERIUM FREMYELLA DIPLOSIPHON AT 1.66 ANGSTROMS RESOLUTION

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-PHYCOCYANIN (ALPHA SUBUNIT)

State in the Current Structure

Other States of the Same Protein in the Database

C-PHYCOCYANIN (BETA SUBUNIT)

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)