SAXSdb — 1diz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

3-METHYLADENINE DNA GLYCOSYLASE II

Escherichia coli

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Monomer Protein × 1 DNA 2 PDB declaration: trimeric（3） Consistent with all polymer counts	Chain A； UniProt 1–282	Not recorded	;DNA (5'-D(GPAPCPAPTPGPAP(NRI)PTPGPCPCPT)-3') ; × 1 ;DNA (5'-D(GPGPCPAPAPTPCPAPTPGPTPCPA)-3') ; × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；15% PEG 4000, 100MM HEPES, 100MM NACL, 50MM MGCL2, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.50 Å R-free 0.290
2	Protein–DNA Monomer Protein × 1 DNA 2 PDB declaration: trimeric（3） Consistent with all polymer counts	Chain B； UniProt 1–282	Not recorded	;DNA (5'-D(GPAPCPAPTPGPAP(NRI)PTPGPCPCPT)-3') ; × 1 ;DNA (5'-D(GPGPCPAPAPTPCPAPTPGPTPCPA)-3') ; × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；15% PEG 4000, 100MM HEPES, 100MM NACL, 50MM MGCL2, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.50 Å R-free 0.290

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1DIZ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1MPG 3-METHYLADENINE DNA GLYCOSYLASE II FROM ESCHERICHIA COLI Deposited 1997-10-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–282（282 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；PROTEIN WAS CRYSTALLIZED FROM 4% PEG 8000, 50 MM NACL, 10 MM TRIS-CL (PH 7.5), 7.5 MM KPO4 (PH 5.9),0.1 MM EDTA, 1.5 MM DITHIOTHREITOL	Resolution 1.80 Å R-free 0.247
1MPG 3-METHYLADENINE DNA GLYCOSYLASE II FROM ESCHERICHIA COLI Deposited 1997-10-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–282（282 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；PROTEIN WAS CRYSTALLIZED FROM 4% PEG 8000, 50 MM NACL, 10 MM TRIS-CL (PH 7.5), 7.5 MM KPO4 (PH 5.9),0.1 MM EDTA, 1.5 MM DITHIOTHREITOL	Resolution 1.80 Å R-free 0.247
1PVS 3-methyladenine Glcosylase II(AlkA) Hypoxanthine complex Deposited 2003-06-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–282（282 aa）	Not recorded	7HP 7-HYDROXY-PYRAZOLO[4,3-D]PYRIMIDINE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å R-free 0.292
1PVS 3-methyladenine Glcosylase II(AlkA) Hypoxanthine complex Deposited 2003-06-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–282（282 aa）	Not recorded	7HP 7-HYDROXY-PYRAZOLO[4,3-D]PYRIMIDINE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å R-free 0.292
3CVS Crystal Structure of an AlkA Host/Guest Complex 8oxoGuanine:Adenine Base Pair Deposited 2008-04-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 1–282（282 aa） Chain B 1–282（282 aa） Chain C 1–282（282 aa） Chain D 1–282（282 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop vapor diffusion；pH 8；295 K；PEG4000, NaCl, Na-HEPES, MgCl2, ethylene glycol, pH 8.0, hanging drop vapor diffusion, temperature 295K	Resolution 2.40 Å R-free 0.270
3CVT Crystal Structure of an AlkA Host/Guest Complex 8oxoGuanine:Cytosine Base Pair Deposited 2008-04-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 1–282（282 aa） Chain B 1–282（282 aa） Chain C 1–282（282 aa） Chain D 1–282（282 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop vapor diffusion；pH 8；295 K；PEG4000, NaCl, Na-HEPES, MgCl2, ethylene glycol, pH 8.0, hanging drop vapor diffusion, temperature 295K	Resolution 2.50 Å R-free 0.274
3CW7 Crystal Structure of an AlkA Host/Guest Complex 8oxoGuanine:Cytosine Base Pair Deposited 2008-04-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 1–282（282 aa） Chain B 1–282（282 aa） Chain C 1–282（282 aa） Chain D 1–282（282 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop vapor diffusion；pH 8；295 K；PEG4000, NaCl, Na-HEPES, MgCl2, ethylene glycol, pH 8.0, hanging drop vapor diffusion, temperature 295K	Resolution 2.30 Å R-free 0.260
3CWA Crystal Structure of an AlkA Host/Guest Complex 8oxoGuanine:Cytosine Base Pair Deposited 2008-04-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 1–282（282 aa） Chain B 1–282（282 aa） Chain C 1–282（282 aa） Chain D 1–282（282 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop vapor diffusion；pH 8；295 K；PEG4000, NaCl, Na-HEPES, MgCl2, ethylene glycol, pH 8.0, hanging drop vapor diffusion, temperature 295K	Resolution 2.40 Å R-free 0.260
3CWS Crystal Structure of an AlkA Host/Guest Complex 2'-fluoro-2'-deoxyinosine:Thymine Base Pair Deposited 2008-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 1–282（282 aa） Chain B 1–282（282 aa） Chain C 1–282（282 aa） Chain D 1–282（282 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop vapor diffusion；pH 8；295 K；PEG4000, NaCl, Na-HEPES, MgCl2, ethylene glycol, pH 8.0, hanging drop vapor diffusion, temperature 295K	Resolution 2.30 Å R-free 0.253
3CWT Crystal Structure of an AlkA Host/Guest Complex 2'-fluoro-2'-deoxyinosine:Adenine Base Pair Deposited 2008-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 1–282（282 aa） Chain B 1–282（282 aa） Chain C 1–282（282 aa） Chain D 1–282（282 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop vapor diffusion；pH 8；295 K；PEG4000, NaCl, Na-HEPES, MgCl2, ethylene glycol, pH 8.0, hanging drop vapor diffusion, temperature 295K	Resolution 2.30 Å R-free 0.280
3CWU Crystal Structure of an AlkA Host/Guest Complex 2'-fluoro-2'-deoxy-1,N6-ethenoadenine:Thymine Base Pair Deposited 2008-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 1–282（282 aa） Chain B 1–282（282 aa） Chain C 1–282（282 aa） Chain D 1–282（282 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop vapor diffusion；pH 8；295 K；PEG4000, NaCl, Na-HEPES, MgCl2, ethylene glycol, pH 8.0, hanging drop vapor diffusion, temperature 295K	Resolution 2.80 Å R-free 0.273
3D4V Crystal Structure of an AlkA Host/Guest Complex N7MethylGuanine:Cytosine Base Pair Deposited 2008-05-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 1–282（282 aa） Chain B 1–282（282 aa） Chain C 1–282（282 aa） Chain D 1–282（282 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；295 K；PEG4000, NaCl, Na-HEPES, MgCl2, ethylene glycol, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.275
3OGD AlkA Undamaged DNA Complex: Interrogation of a G*:C base pair Deposited 2010-08-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 2–282（281 aa）	Mutation：L125C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；25-29% peg3350, 100mM Bis-Tris 6.0-6.6, 200mM LiSo, 3% 6-aminocaproic acid, pH 6.0-6.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.80 Å R-free 0.269
3OH6 AlkA Undamaged DNA Complex: Interrogation of a C:G base pair Deposited 2010-08-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 2–282（281 aa）	Mutation：Y239C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；25-29% peg3350, 100mM BisTris, 200mM Li2SO4, 3% 6-aminocaproic acid, pH 6.0-6.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.89 Å R-free 0.269
3OH6 AlkA Undamaged DNA Complex: Interrogation of a C:G base pair Deposited 2010-08-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 2 PDB declaration: hexameric	Chain A 2–282（281 aa）	Mutation：Y239C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；25-29% peg3350, 100mM BisTris, 200mM Li2SO4, 3% 6-aminocaproic acid, pH 6.0-6.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.89 Å R-free 0.269
3OH9 AlkA Undamaged DNA Complex: Interrogation of a T:A base pair Deposited 2010-08-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 2–282（281 aa）	Mutation：Y239C	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；25-29% peg3350, 100mM bistris, 200mM Li2SO4, 3% 6-aminocaproic acid, pH 6.0-6.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.80 Å R-free 0.257

13 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	3MG2_ECOLI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–282； UniProt 1–282 Author chain B； PDBConstruct 1–282； UniProt 1–282

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1diz
Deposition date deposition_date	1999-11-30
Structure title title	CRYSTAL STRUCTURE OF E. COLI 3-METHYLADENINE DNA GLYCOSYLASE (ALKA) COMPLEXED WITH DNA
Keywords keywords	3-METHYLADENINE DNA GLYCOSYLASE, ALKA, HELIX-HAIRPIN-HELIX, PROTEIN-DNA COMPLEX, 1-AZARIBOSE, HYDROLASE-DNA COMPLEX; HYDROLASE/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	30.70 Å
Radius of gyration Rg (electron density) rg_electron	28.48 Å
Forward intensity I(0) i0	118840000.00
Molecular weight molecular_weight	77981.0 kDa
Excluded volume excluded_volume	93918 Å³
Envelope volume envelope_volume	120520 Å³
Hydration-shell volume shell_volume	35727 Å³
Envelope diameter envelope_diameter	116.7 Å
Shell Rg shell_rg	35.01 Å
Envelope Rg envelope_rg	28.98 Å
Shape Rg shape_rg	28.40 Å
Total Rg total_rg	29.27 Å
Total atoms total_atoms	5436
Residues n_residues	614
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	112.0 Å
Rg (real space) rg_real	30.81 Å
Rg uncertainty (real space) rg_real_error	1.09 Å
I(0) (real space) i0_real	1.1880e+08
I(0) uncertainty (real space) i0_real_error	1.8740e+06
Rg (reciprocal space) rg_reciprocal	30.76 Å
I(0) (reciprocal space) i0_reciprocal	118800000.0000
Solution quality estimate total_estimate	0.8358
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	34.5 Å
Skewness Skewness skewness	0.476
Kurtosis Kurtosis kurtosis	-0.123
Angular range angular_range	— – 0.2600 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	15190000.0000
Real-space data points n_real_points	53
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.688; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.858; Smooth: 0.940

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	;DNA (5'-D(GPAPCPAPTPGPAP(NRI)PTPGPCPCP*T)-3') ;
Molecular weight formula_weight	3841.5 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C,E
Atom count atom_count	5643

GACATGAXTGCCT

Entity 2 Entity 2 polymer

Description description	;DNA (5'-D(GPGPCPAPAPTPCPAPTPGPTPCP*A)-3') ;
Molecular weight formula_weight	3975.6 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	D,F

GGCAATCATGTCA

Entity 3 Entity 3 polymer

Description description	3-METHYLADENINE DNA GLYCOSYLASE II
Molecular weight formula_weight	31425.2 kDa
EC 编号 ec_number	3.2.2.21
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B

MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA

来源 Source

来源生物 organism	Escherichia coli
NCBI Class编号 ncbi_taxonomy_id	562
宿主生物 host_organism	Escherichia coli

Entity 4 Entity 4 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	207

▼

7. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1diza1
Class class	a — All alpha proteins
Fold Fold fold	a.96 — DNA-glycosylase
Superfamily Superfamily superfamily	a.96.1 — DNA-glycosylase
Family Family family	a.96.1.3 — DNA repair glycosylase, 2 C-terminal domains

Domain ID domain_id	d1diza2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.129 — TBP-like
Superfamily Superfamily superfamily	d.129.1 — TATA-box binding protein-like
Family Family family	d.129.1.2 — DNA repair glycosylase, N-terminal domain

Domain ID domain_id	d1dizb1
Class class	a — All alpha proteins
Fold Fold fold	a.96 — DNA-glycosylase
Superfamily Superfamily superfamily	a.96.1 — DNA-glycosylase
Family Family family	a.96.1.3 — DNA repair glycosylase, 2 C-terminal domains

Domain ID domain_id	d1dizb2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.129 — TBP-like
Superfamily Superfamily superfamily	d.129.1 — TATA-box binding protein-like
Family Family family	d.129.1.2 — DNA repair glycosylase, N-terminal domain

CATH v4.4 (6 domains)

Domain ID domain_id	1dizA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	310 — TATA-Binding Protein
Homologous superfamily homologous superfamily	20 — DNA-3-methyladenine glycosylase AlkA, N-terminal domain

Domain ID domain_id	1dizA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	340 — Endonuclease III; domain 1
Homologous superfamily homologous superfamily	30 — Hypothetical protein; domain 2

Domain ID domain_id	1dizA03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1670 — Endonuclease Iii, domain 2
Homologous superfamily homologous superfamily	10 — Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal)

Domain ID domain_id	1dizB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	310 — TATA-Binding Protein
Homologous superfamily homologous superfamily	20 — DNA-3-methyladenine glycosylase AlkA, N-terminal domain

Domain ID domain_id	1dizB02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	340 — Endonuclease III; domain 1
Homologous superfamily homologous superfamily	30 — Hypothetical protein; domain 2

Domain ID domain_id	1dizB03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1670 — Endonuclease Iii, domain 2
Homologous superfamily homologous superfamily	10 — Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal)

▶

8. Citations (1)

▶

Unit-cell length a length_a	82.400 Å
Unit-cell length b length_b	82.400 Å
Unit-cell length c length_c	199.700 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 31 2 1
Space-group number int_tables_number	152
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	10.000 Å
R factor r_factor	0.2500
R_work r_work	0.2500
R_free r_free	0.2900

fit	/app/data/saxs_computation/di/1diz/1diz.fit
pddf	/app/data/pr_computation/di/1diz/1diz.pr.out
profile	/app/data/saxs_computation/di/1diz/1diz.dat

CRYSTAL STRUCTURE OF E. COLI 3-METHYLADENINE DNA GLYCOSYLASE (ALKA) COMPLEXED WITH DNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

3-METHYLADENINE DNA GLYCOSYLASE II

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (4 domains)

CATH v4.4 (6 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)