SAXSdb — 1js8

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hemocyanin

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Monomer	Protein 1 其他Polymer 1	;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose ; × 1 alpha-D-mannopyranose × 1 CU2-O2 CLUSTER × 1 water × 1	Consistent with protein count
2	Other combination	Monomer	Protein 1 其他Polymer 2	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 alpha-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]alpha-D-mannopyranose × 1 CU2-O2 CLUSTER × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HCYG_OCTDO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–394； UniProt 2503–2896 Author chain B； PDBConstruct 1–394； UniProt 2503–2896

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1js8
Deposition date deposition_date	2001-08-16
Structure title title	Structure of a Functional Unit from Octopus Hemocyanin
Keywords keywords	GLYCOPROTEIN, MOLLUSC, OXYGEN-TRANSPORT, THIOETHER BOND, OXYGEN STORAGE-TRANSPORT COMPLEX; OXYGEN STORAGE/TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1js8__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1js8__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1js8__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.65 Å
Rg (electron density)	20.53 Å
Total Rg	21.50 Å
Atom count	3132
Residues	382
Excluded volume	55276 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1js8__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1js8__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Hemocyanin
Molecular weight formula_weight	44810.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	6593

AIIRKNVNSLTPSDIKELRDAMAKVQADTSDNGYQKIASYHGIPLSCHYENGTAYACCQHGMVTFPNWHRLLTKQMEDALVAKGSHVGIPYWDWTTTFANLPVLVTEEKDNSFHHAHIDVANTDTTRSPRAQLFDDPDKGDKSFFYRQIALALEQTDFCDFEIQFEIGHNAIHSWVGGSSPYGMSTLHYTSYDPLFYLHHSNTDRIWSVWQALQKYRGLPYNTANCEINKLVKPLKPFNLDTNPNAVTKAHSTGATSFDYHKLGYDYDNLNFHGMTIPELEEHLKEIQHEDRVFAGFLLRTIGQSADVNFDVCTKDGECTFGGTFCILGGEHEMFWAFDRLFKYDITTSLKHLRLDAHDDFDIKVTIKGIDGHVLSNKYLSPPTVFLAPAKTTH

Entity 2 Entity 2 branched

Description description	;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose ;
Molecular weight formula_weight	1235.1 kDa
Source method src_method	man
Copy count entity_count	1

Entity 3 Entity 3 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	1

Entity 4 Entity 4 branched

Description description	alpha-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]alpha-D-mannopyranose
Molecular weight formula_weight	504.4 kDa
Source method src_method	man
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	alpha-D-mannopyranose
Molecular weight formula_weight	180.2 kDa
Source method src_method	man
Copy count entity_count	1

Entity 6 Entity 6 non-polymer

Description description	CU2-O2 CLUSTER
Molecular weight formula_weight	159.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	296

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1js8a1
Class class	a — All alpha proteins
Fold Fold fold	a.86 — Di-copper centre-containing domain
Superfamily Superfamily superfamily	a.86.1 — Di-copper centre-containing domain
Family Family family	a.86.1.1 — Hemocyanin middle domain

Domain ID domain_id	d1js8a2
Class class	b — All beta proteins
Fold Fold fold	b.112 — C-terminal domain of mollusc hemocyanin
Superfamily Superfamily superfamily	b.112.1 — C-terminal domain of mollusc hemocyanin
Family Family family	b.112.1.1 — C-terminal domain of mollusc hemocyanin

Domain ID domain_id	d1js8b1
Class class	a — All alpha proteins
Fold Fold fold	a.86 — Di-copper centre-containing domain
Superfamily Superfamily superfamily	a.86.1 — Di-copper centre-containing domain
Family Family family	a.86.1.1 — Hemocyanin middle domain

Domain ID domain_id	d1js8b2
Class class	b — All beta proteins
Fold Fold fold	b.112 — C-terminal domain of mollusc hemocyanin
Superfamily Superfamily superfamily	b.112.1 — C-terminal domain of mollusc hemocyanin
Family Family family	b.112.1.1 — C-terminal domain of mollusc hemocyanin

CATH v4.4 (4 domains)

Domain ID domain_id	1js8A01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1280 — di-copper center containing domain from catechol oxidase
Homologous superfamily homologous superfamily	10 — Di-copper center containing domain from catechol oxidase

Domain ID domain_id	1js8A02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	310 — Hemocyanin; Chain: A, domain 2
Homologous superfamily homologous superfamily	10 — Haemocyanin C-terminal domain

Domain ID domain_id	1js8B01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1280 — di-copper center containing domain from catechol oxidase
Homologous superfamily homologous superfamily	10 — Di-copper center containing domain from catechol oxidase

Domain ID domain_id	1js8B02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	310 — Hemocyanin; Chain: A, domain 2
Homologous superfamily homologous superfamily	10 — Haemocyanin C-terminal domain

▶

Unit-cell length a length_a	92.860 Å
Unit-cell length b length_b	168.390 Å
Unit-cell length c length_c	58.290 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	10.000 Å
R factor r_factor	0.2010
R_work r_work	0.2020
R_free r_free	0.2620

Structure of a Functional Unit from Octopus Hemocyanin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hemocyanin

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1js8__assembly_2__model_1

1js8__assembly_2__model_1 | I(q)

1js8__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 branched

Entity 3 Entity 3 branched

Entity 4 Entity 4 branched

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Structure of a Functional Unit from Octopus Hemocyanin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hemocyanin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1js8__assembly_2__model_1

1js8__assembly_2__model_1 | I(q)

1js8__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 branched

Entity 3 Entity 3 branched

Entity 4 Entity 4 branched

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)