SAXSdb — 1lcs

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

No usable UniProt protein identity is available for this entry.

The relationship tables retain this entry's assembly and composition data, but cross-PDB links for the same protein cannot be established reliably without a unified protein identity.

Assembly Composition of the Current Entry

Assembly	Physical composition	Protein state	蛋白 / DNA / RNA / 其他Polymer	Data consistency
1	Other combination	Monomer	1 / 0 / 0 / 2	Consistent with protein count
2	Other combination	Monomer	1 / 0 / 0 / 2	Consistent with protein count
3	Other combination	Homooligomer	4 / 0 / 0 / 8	Consistent with protein count
4	Other combination	Homooligomer	2 / 0 / 0 / 4	Consistent with protein count

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1lcs
Deposition date deposition_date	2002-04-06
Structure title title	RECEPTOR-BINDING DOMAIN FROM SUBGROUP B FELINE LEUKEMIA VIRUS
Keywords keywords	antiparallel beta-sandwich glycoprotein, Viral protein; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1lcs__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1lcs__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1lcs__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.30 Å
Rg (electron density)	18.36 Å
Total Rg	19.26 Å
Atom count	1693
Residues	205
Excluded volume	29742 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1lcs__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1lcs__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1lcs__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1lcs__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	FELINE LEUKEMIA VIRUS RECEPTOR-BINDING DOMAIN
Molecular weight formula_weight	23410.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3539

NPSPHQVYNVTWTITNLVTGTKANATSMLGTLTDAFPTMYFDLCDIIGNTWNPSDQEPFPGYGCDQPMRRWQQRNTPFYVCPGHANRKQCGGPQDGFCAVWGCETTGETYWRPTSSWDYITVKKGVTQGIYQCSGGGWCGPCYDKAVHSSTTGASEGGRCNPLILQFTQKGRQTSWDGPKSWGLRLYRSGYDPIALFSVSRQVMTITPPQA

Source Source

Source organism organism	Feline leukemia virus
NCBI taxonomy ID ncbi_taxonomy_id	103916
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	3

Entity 3 Entity 3 branched

Description description	;2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-2)-beta-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	951.9 kDa
Source method src_method	man
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXYL
Molecular weight formula_weight	164.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	178

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d1lcsa_
Class class	b — All beta proteins
Fold Fold fold	b.20 — ENV polyprotein, receptor-binding domain
Superfamily Superfamily superfamily	b.20.1 — ENV polyprotein, receptor-binding domain
Family Family family	b.20.1.1 — ENV polyprotein, receptor-binding domain

Domain ID domain_id	d1lcsb_
Class class	b — All beta proteins
Fold Fold fold	b.20 — ENV polyprotein, receptor-binding domain
Superfamily Superfamily superfamily	b.20.1 — ENV polyprotein, receptor-binding domain
Family Family family	b.20.1.1 — ENV polyprotein, receptor-binding domain

CATH v4.4 (2 domains)

Domain ID domain_id	1lcsA00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	310 — Viral Glycoprotein Gp70
Homologous superfamily homologous superfamily	10 — ENV polyprotein, receptor-binding domain

Domain ID domain_id	1lcsB00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	310 — Viral Glycoprotein Gp70
Homologous superfamily homologous superfamily	10 — ENV polyprotein, receptor-binding domain

▶

Unit-cell length a length_a	93.400 Å
Unit-cell length b length_b	93.400 Å
Unit-cell length c length_c	231.500 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 65 2 2
Space-group number int_tables_number	179
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	—
R_work r_work	0.2160
R_free r_free	0.2640

RECEPTOR-BINDING DOMAIN FROM SUBGROUP B FELINE LEUKEMIA VIRUS