SAXSdb — 1miu

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Deleted in split hand/split foot protein 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Breast Cancer type 2 susceptibility protein × 1 （P97929） MERCURY (II) ION × 5	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Breast Cancer type 2 susceptibility protein × 4 （P97929） MERCURY (II) ION × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DSS1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–70； UniProt 1–70

Breast Cancer type 2 susceptibility protein

Mus musculus

UniProt P97929

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Deleted in split hand/split foot protein 1 × 1 （P60896） MERCURY (II) ION × 5	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Deleted in split hand/split foot protein 1 × 4 （P60896） MERCURY (II) ION × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BRCA2_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–738； UniProt 2378–3115

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1miu
Deposition date deposition_date	2002-08-23
Structure title title	Structure of a BRCA2-DSS1 complex
Keywords keywords	TUMOR SUPPRESSOR, BREAST CANCER SUSCEPTIBILITY, DNA-BINDING, GENE REGULATION-ANTITUMOR PROTEIN COMPLEX; GENE REGULATION/ANTITUMOR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1miu__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1miu__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1miu__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.11 Å
Rg (electron density)	42.51 Å
Total Rg	42.30 Å
Atom count	5647
Residues	713
Excluded volume	100530 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1miu__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1miu__assembly_2__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Deleted in split hand/split foot protein 1
Molecular weight formula_weight	8284.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	5647

MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Breast Cancer type 2 susceptibility protein
Molecular weight formula_weight	83350.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

NQKSTDGDREDGNDSHVRQFNKDLMSSLQSARDLQDMRIKNKERRHLRLQPGSLYLTKSSTLPRISLQAAVGDRAPSACSPKQLYIYGVSKECINVNSKNAEYFQFDIQDHFGKEDLCAGKGFQLADGGWLIPSNDGKAGKEEFYRALCDTPGVDPKLISSIWVANHYRWIVWKLAAMEFAFPKEFANRCLNPERVLLQLKYRYDVEIDNSRRSALKKILERDDTAAKTLVLCISDIISPSTKVSETSGGKTSGEDANKVDTIELTDGWYAVRAQLDPPLMALVKSGKLTVGQKIITQGAELVGSPDACAPLEAPDSLRLKISANSTRPARWHSRLGFFRDPRPFPLPLSSLFSDGGNVGCVDIIVQRVYPLQWVEKTVSGLYIFRSEREEEKEALRFAEAQQKKLEALFTKVHTEFKDHEEDTTQRCVLSRTLTRQQVHALQDGAELYAAVQYASDPDHLEACFSEEQLRALNNYRQMLNDKKQARIQSEFRKALESAEKEEGLSRDVTTVWKLRVTSYKKKEKSALLSIWRPSSDLSSLLTEGKRYRIYHLAVSKSKSKFERPSIQLTATKRTQYQQLPVSSETLLQVYQPRESLHFSRLSDPAFQPPCSEVDVVGVVVSVVKPIGLAPLVYLSDECLNLLVVKFGIDLNEDIKPRVLIAASNLQCQPESTSGVPTLFAGHFSIFSASPKEAYFQEKVNNLKHAIENIDTFYKEAEKKLIHVLEGDSPKWSTPNKD

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Spodoptera frugiperda

Entity 3 Entity 3 non-polymer

Description description	MERCURY (II) ION
Molecular weight formula_weight	200.6 kDa
Source method src_method	syn
Copy count entity_count	5

▼

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d1miua1
Class class	a — All alpha proteins
Fold Fold fold	a.170 — BRCA2 helical domain
Superfamily Superfamily superfamily	a.170.1 — BRCA2 helical domain
Family Family family	a.170.1.1 — BRCA2 helical domain

Domain ID domain_id	d1miua2
Class class	a — All alpha proteins
Fold Fold fold	a.171 — BRCA2 tower domain
Superfamily Superfamily superfamily	a.171.1 — BRCA2 tower domain
Family Family family	a.171.1.1 — BRCA2 tower domain

Domain ID domain_id	d1miua3
Class class	b — All beta proteins
Fold Fold fold	b.40 — OB-fold
Superfamily Superfamily superfamily	b.40.4 — Nucleic acid-binding proteins
Family Family family	b.40.4.3 — Single strand DNA-binding domain, SSB

Domain ID domain_id	d1miua4
Class class	b — All beta proteins
Fold Fold fold	b.40 — OB-fold
Superfamily Superfamily superfamily	b.40.4 — Nucleic acid-binding proteins
Family Family family	b.40.4.3 — Single strand DNA-binding domain, SSB

Domain ID domain_id	d1miua5
Class class	b — All beta proteins
Fold Fold fold	b.40 — OB-fold
Superfamily Superfamily superfamily	b.40.4 — Nucleic acid-binding proteins
Family Family family	b.40.4.3 — Single strand DNA-binding domain, SSB

Domain ID domain_id	d1miub_
Class class	j — Peptides
Fold Fold fold	j.136 — SEM1 fragments
Superfamily Superfamily superfamily	j.136.1 — SEM1 fragments
Family Family family	j.136.1.1 — SEM1 fragments

CATH v4.4 (4 domains)

Domain ID domain_id	1miuA02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	1miuA03
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	1miuA04
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	70 — Topoisomerase I; Chain A, domain 4
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	1miuA05
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

▶

Unit-cell length a length_a	160.509 Å
Unit-cell length b length_b	228.271 Å
Unit-cell length c length_c	81.715 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 2
Space-group number int_tables_number	21
Crystal system crystal_system	—

Resolution resolution	3.100 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2600
R_work r_work	0.2560
R_free r_free	0.3100

Structure of a BRCA2-DSS1 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Deleted in split hand/split foot protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Breast Cancer type 2 susceptibility protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1miu__assembly_1__model_1

1miu__assembly_1__model_1 | I(q)

1miu__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (6 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Structure of a BRCA2-DSS1 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Deleted in split hand/split foot protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Breast Cancer type 2 susceptibility protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1miu__assembly_1__model_1

1miu__assembly_1__model_1 | I(q)

1miu__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (6 domains)

CATH v4.4 (4 domains)

7. Citations (1)