SAXSdb — 1mvf

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PemI-like protein 1

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	immunoglobulin heavy chain variable region × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	immunoglobulin heavy chain variable region × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CHPR_ECOLI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–82； UniProt 1–82 Author chain E； PDBConstruct 1–82； UniProt 1–82

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1mvf
Deposition date deposition_date	2002-09-25
Structure title title	MazE addiction antidote
Keywords keywords	plasmid addiction, camel antibody, addiction antidote, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1mvf__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1mvf__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1mvf__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.30 Å
Rg (electron density)	17.60 Å
Total Rg	18.52 Å
Atom count	1217
Residues	166
Excluded volume	21511 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1mvf__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1mvf__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	immunoglobulin heavy chain variable region
Molecular weight formula_weight	14891.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2678

QVQLVESGGGSVQAGGSLRLSCAASGFTYSRKYMGWFRQAPGKEREGVAAIFIDNGNTIYADSVQGRFTISQDNAKNTVYLQMNSLKPEDTAMYYCAASSRWMDYSALTAKAYNSWGQGTQVTVSSRGRHHHHHH

Source Source

Source organism organism	Camelus dromedarius
Common name common_name	Arabian camel
NCBI taxonomy ID ncbi_taxonomy_id	9838
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	PemI-like protein 1
Molecular weight formula_weight	9366.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E

MIHSSVKRWGNSPAVRIPATLMQALNLNIDDEVKIDLVDGKLIIEPVRKEPVFTLAELVNDITPENLHENIDWGEPKDKEVW

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	189

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1mvfa_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d1mvfb_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d1mvfd_
Class class	b — All beta proteins
Fold Fold fold	b.129 — Double-split beta-barrel
Superfamily Superfamily superfamily	b.129.1 — AbrB/MazE/MraZ-like
Family Family family	b.129.1.1 — Kis/PemI addiction antidote

Domain ID domain_id	d1mvfe_
Class class	b — All beta proteins
Fold Fold fold	b.129 — Double-split beta-barrel
Superfamily Superfamily superfamily	b.129.1 — AbrB/MazE/MraZ-like
Family Family family	b.129.1.1 — Kis/PemI addiction antidote

CATH v4.4 (4 domains)

Domain ID domain_id	1mvfA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	1mvfB00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	1mvfD00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	260 — Pemi-like Protein 1; Chain: D
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	1mvfE00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	260 — Pemi-like Protein 1; Chain: D
Homologous superfamily homologous superfamily	10 —

▶

Unit-cell length a length_a	29.440 Å
Unit-cell length b length_b	47.826 Å
Unit-cell length c length_c	128.376 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.59 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.650 Å
Low-resolution limit resolution_low	15.000 Å
R factor r_factor	0.2203
R_work r_work	0.2177
R_free r_free	0.2491

MazE addiction antidote

1. Protein Identity and Related Structures Protein Identity & Related Structures

PemI-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1mvf__assembly_2__model_1

1mvf__assembly_2__model_1 | I(q)

1mvf__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

MazE addiction antidote

1. Protein Identity and Related Structures Protein Identity & Related Structures

PemI-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1mvf__assembly_2__model_1

1mvf__assembly_2__model_1 | I(q)

1mvf__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)