SAXSdb — 1mz9

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

cartilage oligomeric matrix protein

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 5	3-{2-[1-(5-HYDROXY-1,5-DIMETHYL-HEXYL)-7A-METHYL-OCTAHYDRO-INDEN-4-YLIDENE]-ETHYLIDENE}-4-METHYLENE-CYCLOHEXANOL × 2 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COMP_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–45； UniProt 28–71 Author chain B； PDBConstruct 2–45； UniProt 28–71 Author chain C； PDBConstruct 2–45； UniProt 28–71 Author chain D； PDBConstruct 2–45； UniProt 28–71 Author chain E； PDBConstruct 2–45； UniProt 28–71

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1mz9
Deposition date deposition_date	2002-10-07
Structure title title	Storage function of COMP:the crystal structure of the coiled-coil domain in complex with vitamin D3
Keywords keywords	pentameric coiled-coil domain, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1mz9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1mz9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1mz9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.97 Å
Rg (electron density)	20.95 Å
Total Rg	22.13 Å
Atom count	1868
Residues	225
Excluded volume	33740 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1mz9__assembly_1__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	cartilage oligomeric matrix protein
Molecular weight formula_weight	5242.1 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E
Atom count atom_count	2113

MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	3-{2-[1-(5-HYDROXY-1,5-DIMETHYL-HEXYL)-7A-METHYL-OCTAHYDRO-INDEN-4-YLIDENE]-ETHYLIDENE}-4-METHYLENE-CYCLOHEXANOL
Molecular weight formula_weight	400.6 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	245

▼

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (5 domains)

Domain ID domain_id	d1mz9a_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.7 — Assembly domain of cartilage oligomeric matrix protein
Family Family family	h.1.7.1 — Assembly domain of cartilage oligomeric matrix protein

Domain ID domain_id	d1mz9b_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.7 — Assembly domain of cartilage oligomeric matrix protein
Family Family family	h.1.7.1 — Assembly domain of cartilage oligomeric matrix protein

Domain ID domain_id	d1mz9c_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.7 — Assembly domain of cartilage oligomeric matrix protein
Family Family family	h.1.7.1 — Assembly domain of cartilage oligomeric matrix protein

Domain ID domain_id	d1mz9d_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.7 — Assembly domain of cartilage oligomeric matrix protein
Family Family family	h.1.7.1 — Assembly domain of cartilage oligomeric matrix protein

Domain ID domain_id	d1mz9e_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.7 — Assembly domain of cartilage oligomeric matrix protein
Family Family family	h.1.7.1 — Assembly domain of cartilage oligomeric matrix protein

CATH v4.4 (5 domains)

Domain ID domain_id	1mz9A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	1mz9B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	1mz9C00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	1mz9D00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	1mz9E00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	10 —

▶

Unit-cell length a length_a	38.295 Å
Unit-cell length b length_b	49.289 Å
Unit-cell length c length_c	55.260 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	103.87 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	10

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.700 Å
Low-resolution limit resolution_low	5.990 Å
R factor r_factor	0.2310
R_work r_work	0.2310
R_free r_free	0.2540

Storage function of COMP:the crystal structure of the coiled-coil domain in complex with vitamin D3

1. Protein Identity and Related Structures Protein Identity & Related Structures

cartilage oligomeric matrix protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1mz9__assembly_1__model_1

1mz9__assembly_1__model_1 | I(q)

1mz9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (5 domains)

CATH v4.4 (5 domains)

7. Citations (1)

Storage function of COMP:the crystal structure of the coiled-coil domain in complex with vitamin D3

1. Protein Identity and Related Structures Protein Identity & Related Structures

cartilage oligomeric matrix protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1mz9__assembly_1__model_1

1mz9__assembly_1__model_1 | I(q)

1mz9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (5 domains)

CATH v4.4 (5 domains)

7. Citations (1)