SAXSdb — 1nm2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

malonyl CoA:acyl carrier protein malonyltransferase

Streptomyces coelicolor

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	NICKEL (II) ION × 1 ACETIC ACID × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	P72391_STRCO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–317； UniProt 1–316

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1nm2
Deposition date deposition_date	2003-01-08
Structure title title	Malonyl-CoA:ACP Transacylase
Keywords keywords	ALPHA/BETA HYDROLASE-LIKE CORE, ACETATE BOUND TO ACTIVE SITE MIMICKING A MALONYL GROUP, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1nm2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1nm2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1nm2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.68 Å
Rg (electron density)	18.44 Å
Total Rg	19.36 Å
Atom count	2192
Residues	305
Excluded volume	39178 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1nm2__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	malonyl CoA:acyl carrier protein malonyltransferase
Molecular weight formula_weight	32246.7 kDa
EC 编号 ec_number	2.3.1.39
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2300

HMLVLVAPGQGAQTPGFLTDWLALPGAADRVAAWSDAIGLDLAHFGTKADADEIRDTSVAQPLLVAAGILSAAALGTQTSVADATGPGFTPGAVAGHSVGEITAAVFAGVLDDTAALSLVRRRGLAMAEAAAVTETGMSALLGGDPEVSVAHLERLGLTPANVNGAGQIVAAGTMEQLAALNEDKPEGVRKVVPLKVAGAFHTRHMAPAVDKLAEAAKALTPADPKVTYVSNKDGRAVASGTEVLDRLVGQVANPVRWDLCMETFKELGVTAIIEVCPGGTLTGLAKRALPGVKTLALKTPDDLDAARELVAEHTQA

Source Source

Source organism organism	Streptomyces coelicolor
NCBI taxonomy ID ncbi_taxonomy_id	100226
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	NICKEL (II) ION
Molecular weight formula_weight	58.7 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	ACETIC ACID
Molecular weight formula_weight	60.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	108

▼

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1nm2a1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.19 — FabD/lysophospholipase-like
Superfamily Superfamily superfamily	c.19.1 — FabD/lysophospholipase-like
Family Family family	c.19.1.1 — FabD-like

Domain ID domain_id	d1nm2a2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.23 — Probable ACP-binding domain of malonyl-CoA ACP transacylase
Family Family family	d.58.23.1 — Probable ACP-binding domain of malonyl-CoA ACP transacylase

Domain ID domain_id	d1nm2a3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (2 domains)

Domain ID domain_id	1nm2A01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	250 — Malonyl-CoA ACP transacylase, ACP-binding

Domain ID domain_id	1nm2A02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	366 — Malonyl-Coenzyme A Acyl Carrier Protein; domain 2
Homologous superfamily homologous superfamily	10 — Malonyl-Coenzyme A Acyl Carrier Protein, domain 2

▶

Unit-cell length a length_a	43.067 Å
Unit-cell length b length_b	54.486 Å
Unit-cell length c length_c	109.880 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	48.810 Å
R factor r_factor	0.2320
R_work r_work	0.1970
R_free r_free	0.2320

Malonyl-CoA:ACP Transacylase

1. Protein Identity and Related Structures Protein Identity & Related Structures

malonyl CoA:acyl carrier protein malonyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1nm2__assembly_1__model_1

1nm2__assembly_1__model_1 | I(q)

1nm2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (3 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Malonyl-CoA:ACP Transacylase

1. Protein Identity and Related Structures Protein Identity & Related Structures

malonyl CoA:acyl carrier protein malonyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1nm2__assembly_1__model_1

1nm2__assembly_1__model_1 | I(q)

1nm2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (3 domains)

CATH v4.4 (2 domains)

7. Citations (1)