SAXSdb — 1nrz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PTS system, sorbose-specific IIB component

Klebsiella pneumoniae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	SULFATE ION × 2 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	SULFATE ION × 1 water × 1	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	SULFATE ION × 1 water × 1	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 2 water × 2	Consistent with protein count
6	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PTRB_KLEPN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–164； UniProt 1–164 Author chain B； PDBConstruct 1–164； UniProt 1–164 Author chain C； PDBConstruct 1–164； UniProt 1–164 Author chain D； PDBConstruct 1–164； UniProt 1–164

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1nrz
Deposition date deposition_date	2003-01-27
Structure title title	Crystal structure of the IIBSor domain of the sorbose permease from Klebsiella pneumoniae solved to 1.75A resolution
Keywords keywords	BETA SHEET CORE, FLANKING HELICES, RIGHT HANDED BETA-ALPHA-BETA CROSSOVER, transferase; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1nrz__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1nrz__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1nrz__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.72 Å
Rg (electron density)	15.47 Å
Total Rg	16.56 Å
Atom count	1292
Residues	163
Excluded volume	23104 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1nrz__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1nrz__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1nrz__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1nrz__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`1nrz__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`1nrz__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	PTS system, sorbose-specific IIB component
Molecular weight formula_weight	18478.3 kDa
EC 编号 ec_number	2.7.1.69
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	5636

MQITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVFNDEVRRTLLRQAAPPGMKVNVVSLEKAVAVYHNPQYQDETVFYLFTNPHDVLTMVRQGVQIATLNIGGMAWRPGKKQLTKAVSLDPQDIQAFRELDKLGVKLDLRVVASDPSVNILDKINETAFCE

Source Source

Source organism organism	Klebsiella pneumoniae
NCBI taxonomy ID ncbi_taxonomy_id	573
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	468

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1nrza_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.38 — PTS IIb component
Superfamily Superfamily superfamily	c.38.1 — PTS IIb component
Family Family family	c.38.1.1 — PTS IIb component

Domain ID domain_id	d1nrzb_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.38 — PTS IIb component
Superfamily Superfamily superfamily	c.38.1 — PTS IIb component
Family Family family	c.38.1.1 — PTS IIb component

Domain ID domain_id	d1nrzc_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.38 — PTS IIb component
Superfamily Superfamily superfamily	c.38.1 — PTS IIb component
Family Family family	c.38.1.1 — PTS IIb component

Domain ID domain_id	d1nrzd_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.38 — PTS IIb component
Superfamily Superfamily superfamily	c.38.1 — PTS IIb component
Family Family family	c.38.1.1 — PTS IIb component

CATH v4.4 (4 domains)

Domain ID domain_id	1nrzA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	35 — Fructose Permease
Homologous superfamily homologous superfamily	10 — Phosphotransferase system, sorbose subfamily IIB component

Domain ID domain_id	1nrzB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	35 — Fructose Permease
Homologous superfamily homologous superfamily	10 — Phosphotransferase system, sorbose subfamily IIB component

Domain ID domain_id	1nrzC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	35 — Fructose Permease
Homologous superfamily homologous superfamily	10 — Phosphotransferase system, sorbose subfamily IIB component

Domain ID domain_id	1nrzD00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	35 — Fructose Permease
Homologous superfamily homologous superfamily	10 — Phosphotransferase system, sorbose subfamily IIB component

▶

Unit-cell length a length_a	64.848 Å
Unit-cell length b length_b	85.311 Å
Unit-cell length c length_c	67.815 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	103.02 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.750 Å
Low-resolution limit resolution_low	21.370 Å
R factor r_factor	0.2173
R_work r_work	0.2159
R_free r_free	0.2427

Crystal structure of the IIBSor domain of the sorbose permease from Klebsiella pneumoniae solved to 1.75A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

PTS system, sorbose-specific IIB component

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1nrz__assembly_3__model_1

1nrz__assembly_3__model_1 | I(q)

1nrz__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of the IIBSor domain of the sorbose permease from Klebsiella pneumoniae solved to 1.75A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

PTS system, sorbose-specific IIB component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1nrz__assembly_3__model_1

1nrz__assembly_3__model_1 | I(q)

1nrz__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)