SAXSdb — 1o83

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PEPTIDE ANTIBIOTIC AS-48

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	GLYCEROL × 1 PHOSPHATE ION × 1 water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	PHOSPHATE ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q47765
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–70； UniProt 36–105 Author chain B； PDBConstruct 1–70； UniProt 36–105 Author chain C； PDBConstruct 1–70； UniProt 36–105 Author chain D； PDBConstruct 1–70； UniProt 36–105

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1o83
Deposition date deposition_date	2002-11-25
Structure title title	Crystal Structure of Bacteriocin AS-48 at pH 7.5, phosphate bound. Crystal form I
Keywords keywords	;PEPTIDE ANTIBIOTIC, BACTERIOCIN, ANTIBACTERIAL PEPTIDE, MEMBRANE PERMEABILIZATION, PROTEIN CRYSTALLOGRAPHY, CYCLIC POLYPEPTIDE, PROTEIN MEMBRANE INTERACTION ;; PEPTIDE ANTIBIOTIC
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1o83__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1o83__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1o83__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	12.33 Å
Rg (electron density)	10.72 Å
Total Rg	12.29 Å
Atom count	504
Residues	70
Excluded volume	9293 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1o83__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1o83__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1o83__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1o83__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	PEPTIDE ANTIBIOTIC AS-48
Molecular weight formula_weight	7177.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	2415

MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW

Entity 2 Entity 2 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	383

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1o83a_
Class class	a — All alpha proteins
Fold Fold fold	a.64 — Saposin-like
Superfamily Superfamily superfamily	a.64.2 — Bacteriocin AS-48
Family Family family	a.64.2.1 — Bacteriocin AS-48

Domain ID domain_id	d1o83b_
Class class	a — All alpha proteins
Fold Fold fold	a.64 — Saposin-like
Superfamily Superfamily superfamily	a.64.2 — Bacteriocin AS-48
Family Family family	a.64.2.1 — Bacteriocin AS-48

Domain ID domain_id	d1o83c_
Class class	a — All alpha proteins
Fold Fold fold	a.64 — Saposin-like
Superfamily Superfamily superfamily	a.64.2 — Bacteriocin AS-48
Family Family family	a.64.2.1 — Bacteriocin AS-48

Domain ID domain_id	d1o83d_
Class class	a — All alpha proteins
Fold Fold fold	a.64 — Saposin-like
Superfamily Superfamily superfamily	a.64.2 — Bacteriocin AS-48
Family Family family	a.64.2.1 — Bacteriocin AS-48

CATH v4.4 (4 domains)

Domain ID domain_id	1o83A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	225 — Bacteriocin As-48; Chain A
Homologous superfamily homologous superfamily	10 — Bacteriocin AS-48

Domain ID domain_id	1o83B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	225 — Bacteriocin As-48; Chain A
Homologous superfamily homologous superfamily	10 — Bacteriocin AS-48

Domain ID domain_id	1o83C00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	225 — Bacteriocin As-48; Chain A
Homologous superfamily homologous superfamily	10 — Bacteriocin AS-48

Domain ID domain_id	1o83D00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	225 — Bacteriocin As-48; Chain A
Homologous superfamily homologous superfamily	10 — Bacteriocin AS-48

▶

Unit-cell length a length_a	79.670 Å
Unit-cell length b length_b	83.880 Å
Unit-cell length c length_c	99.770 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	I 2 2 2
Space-group number int_tables_number	23
Crystal system crystal_system	—

Resolution resolution	1.640 Å
Low-resolution limit resolution_low	15.000 Å
R factor r_factor	0.1950
R_work r_work	0.1930
R_free r_free	0.2150

Crystal Structure of Bacteriocin AS-48 at pH 7.5, phosphate bound. Crystal form I

1. Protein Identity and Related Structures Protein Identity & Related Structures

PEPTIDE ANTIBIOTIC AS-48

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1o83__assembly_3__model_1

1o83__assembly_3__model_1 | I(q)

1o83__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal Structure of Bacteriocin AS-48 at pH 7.5, phosphate bound. Crystal form I

1. Protein Identity and Related Structures Protein Identity & Related Structures

PEPTIDE ANTIBIOTIC AS-48

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1o83__assembly_3__model_1

1o83__assembly_3__model_1 | I(q)

1o83__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)