SAXSdb — 1oqv

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

toxin-coregulated pilus subunit

Vibrio cholerae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	GLYCEROL × 1 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	GLYCEROL × 2 water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPA2_VIBCH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 22–192； UniProt 29–199 Author chain B； PDBConstruct 22–192； UniProt 29–199 Author chain C； PDBConstruct 22–192； UniProt 29–199

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1oqv
Deposition date deposition_date	2003-03-11
Structure title title	Structure of TcpA, the Type IV pilin subunit from the toxin co-regulated pilus of Vibrio cholerae classical biotype
Keywords keywords	TcpA, Type IV pilin, pilin, pilus filament, Vibrio cholerae, fiber forming protein, adhesin, fimbriae, CELL ADHESION; CELL ADHESION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1oqv__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1oqv__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1oqv__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.01 Å
Rg (electron density)	14.80 Å
Total Rg	15.95 Å
Atom count	1239
Residues	171
Excluded volume	22105 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1oqv__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1oqv__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1oqv__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	toxin-coregulated pilus subunit
Molecular weight formula_weight	19794.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	4577

MGSSHHHHHHSSGLVPRGSHMDSQNMTKAAQSLNSIQVALTQTYRGLGNYPATADATAASKLTSGLVSLGKISSDEAKNPFIGTNMNIFSFPRNAAANKAFAISVDGLTQAQCKTLITSVGDMFPYIAIKAGGAVALADLGDFENSAAAAETGVGVIKSIAPASKNLDLTNITHVEKLCKGTAPFGVAFGNS

Source Source

Source organism organism	Vibrio cholerae
NCBI taxonomy ID ncbi_taxonomy_id	666
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	765

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1oqva_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.24 — Pili subunits
Superfamily Superfamily superfamily	d.24.1 — Pili subunits
Family Family family	d.24.1.2 — TcpA-like pilin

Domain ID domain_id	d1oqvb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.24 — Pili subunits
Superfamily Superfamily superfamily	d.24.1 — Pili subunits
Family Family family	d.24.1.2 — TcpA-like pilin

Domain ID domain_id	d1oqvc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.24 — Pili subunits
Superfamily Superfamily superfamily	d.24.1 — Pili subunits
Family Family family	d.24.1.2 — TcpA-like pilin

CATH v4.4 (3 domains)

Domain ID domain_id	1oqvA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1690 — TcpA-like pilin
Homologous superfamily homologous superfamily	10 — TcpA-like pilin

Domain ID domain_id	1oqvB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1690 — TcpA-like pilin
Homologous superfamily homologous superfamily	10 — TcpA-like pilin

Domain ID domain_id	1oqvC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1690 — TcpA-like pilin
Homologous superfamily homologous superfamily	10 — TcpA-like pilin

▶

Unit-cell length a length_a	157.317 Å
Unit-cell length b length_b	157.317 Å
Unit-cell length c length_c	35.719 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	P 63
Space-group number int_tables_number	173
Crystal system crystal_system	—

Resolution resolution	1.300 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.1130
R_work r_work	0.1160
R_free r_free	0.1740

Structure of TcpA, the Type IV pilin subunit from the toxin co-regulated pilus of Vibrio cholerae classical biotype

1. Protein Identity and Related Structures Protein Identity & Related Structures

toxin-coregulated pilus subunit

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1oqv__assembly_2__model_1

1oqv__assembly_2__model_1 | I(q)

1oqv__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

7. Citations (1)

Structure of TcpA, the Type IV pilin subunit from the toxin co-regulated pilus of Vibrio cholerae classical biotype

1. Protein Identity and Related Structures Protein Identity & Related Structures

toxin-coregulated pilus subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1oqv__assembly_2__model_1

1oqv__assembly_2__model_1 | I(q)

1oqv__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

7. Citations (1)