SAXSdb — 1puo

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major allergen I polypeptide, fused chain 2, chain 1

Felis catus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	(4S)-2-METHYL-2,4-PENTANEDIOL × 2 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	(4S)-2-METHYL-2,4-PENTANEDIOL × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FELA_FELCA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 93–162； UniProt 23–92 Author chain B； PDBConstruct 93–162； UniProt 23–92

Major allergen I polypeptide, fused chain 2, chain 1

Felis catus

UniProt P30440

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	(4S)-2-METHYL-2,4-PENTANEDIOL × 2 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	(4S)-2-METHYL-2,4-PENTANEDIOL × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FEL2_FELCA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–92； UniProt 18–109 Author chain B； PDBConstruct 1–92； UniProt 18–109

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1puo
Deposition date deposition_date	2003-06-25
Structure title title	Crystal structure of Fel d 1- the major cat allergen
Keywords keywords	cat allergen, uteroglobin, secretoglobin, ALLERGEN; ALLERGEN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1puo__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1puo__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1puo__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.27 Å
Rg (electron density)	14.03 Å
Total Rg	15.26 Å
Atom count	1113
Residues	141
Excluded volume	20148 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1puo__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1puo__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Major allergen I polypeptide, fused chain 2, chain 1
Molecular weight formula_weight	19074.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2467

VKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKDCMGEAVQNTVEDLKLNTLGREICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSLLDKIYTSPLCLEHHHHHH

Source Source

Source organism organism	Felis catus
Common name common_name	domestic cat
NCBI taxonomy ID ncbi_taxonomy_id	9685
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	(4S)-2-METHYL-2,4-PENTANEDIOL
Molecular weight formula_weight	118.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	233

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d1puoa1
Class class	a — All alpha proteins
Fold Fold fold	a.101 — Uteroglobin-like
Superfamily Superfamily superfamily	a.101.1 — Uteroglobin-like
Family Family family	a.101.1.1 — Uteroglobin-like

Domain ID domain_id	d1puoa2
Class class	a — All alpha proteins
Fold Fold fold	a.101 — Uteroglobin-like
Superfamily Superfamily superfamily	a.101.1 — Uteroglobin-like
Family Family family	a.101.1.1 — Uteroglobin-like

Domain ID domain_id	d1puoa3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1puob1
Class class	a — All alpha proteins
Fold Fold fold	a.101 — Uteroglobin-like
Superfamily Superfamily superfamily	a.101.1 — Uteroglobin-like
Family Family family	a.101.1.1 — Uteroglobin-like

Domain ID domain_id	d1puob2
Class class	a — All alpha proteins
Fold Fold fold	a.101 — Uteroglobin-like
Superfamily Superfamily superfamily	a.101.1 — Uteroglobin-like
Family Family family	a.101.1.1 — Uteroglobin-like

Domain ID domain_id	d1puob3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (2 domains)

Domain ID domain_id	1puoA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	920 — Histone Acetyltransferase; Chain A
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	1puoB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	920 — Histone Acetyltransferase; Chain A
Homologous superfamily homologous superfamily	50 —

▶

Unit-cell length a length_a	43.290 Å
Unit-cell length b length_b	51.539 Å
Unit-cell length c length_c	67.725 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	95.27 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.850 Å
Low-resolution limit resolution_low	24.040 Å
R factor r_factor	0.2028
R_work r_work	0.2009
R_free r_free	0.2373

Crystal structure of Fel d 1- the major cat allergen

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major allergen I polypeptide, fused chain 2, chain 1

State in the Current Structure

Other States of the Same Protein in the Database

Major allergen I polypeptide, fused chain 2, chain 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1puo__assembly_1__model_1

1puo__assembly_1__model_1 | I(q)

1puo__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (6 domains)

CATH v4.4 (2 domains)

7. Citations (2)

Crystal structure of Fel d 1- the major cat allergen

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major allergen I polypeptide, fused chain 2, chain 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Major allergen I polypeptide, fused chain 2, chain 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1puo__assembly_1__model_1

1puo__assembly_1__model_1 | I(q)

1puo__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (6 domains)

CATH v4.4 (2 domains)

7. Citations (2)