SAXSdb — 1rh6

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Excisionase

Enterobacteria phage lambda

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Monomer	Protein 1 DNA 2	5'-D(CPTPAPTPGPTPAPGPTPCPTPGPTPTPG)-3' × 1 5'-D(PCPAPAPCPAPGPAPCPTPAPCPAPTPAPG)-3' × 1 water × 3	Consistent with all polymers
2	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VXIS_LAMBD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–55； UniProt 1–55 Author chain B； PDBConstruct 1–55； UniProt 1–55

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1rh6
Deposition date deposition_date	2003-11-13
Structure title title	Bacteriophage Lambda Excisionase (Xis)-DNA Complex
Keywords keywords	;Protein-DNA complex, DNA architectural protein, 'winged'-helix protein, phage excision, site-specific DNA recombination, DNA BINDING PROTEIN-DNA COMPLEX ;; DNA BINDING PROTEIN/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1rh6__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1rh6__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1rh6__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	12.64 Å
Rg (electron density)	11.17 Å
Total Rg	12.72 Å
Atom count	478
Residues	55
Excluded volume	8449 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1rh6__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1rh6__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	5'-D(CPTPAPTPGPTPAPGPTPCPTPGPTPTP*G)-3'
Molecular weight formula_weight	4606.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C
Atom count atom_count	1657

CTATGTAGTCTGTTG

Entity 2 Entity 2 polymer

Description description	5'-D(PCPAPAPCPAPGPAPCPTPAPCPAPTPAP*G)-3'
Molecular weight formula_weight	4571.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	D

CAACAGACTACATAG

Entity 3 Entity 3 polymer

Description description	Excisionase
Molecular weight formula_weight	6793.8 kDa
Mutation mutation	C28S
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B

MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKVDLNRP

Source Source

Source organism organism	Enterobacteria phage lambda
NCBI taxonomy ID ncbi_taxonomy_id	10710
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	152

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d1rh6a_
Class class	a — All alpha proteins
Fold Fold fold	a.6 — Putative DNA-binding domain
Superfamily Superfamily superfamily	a.6.1 — Putative DNA-binding domain
Family Family family	a.6.1.7 — Excisionase-like

Domain ID domain_id	d1rh6b_
Class class	a — All alpha proteins
Fold Fold fold	a.6 — Putative DNA-binding domain
Superfamily Superfamily superfamily	a.6.1 — Putative DNA-binding domain
Family Family family	a.6.1.7 — Excisionase-like

CATH v4.4 (2 domains)

Domain ID domain_id	1rh6A00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1660 — Multidrug-efflux Transporter Regulator; Chain: A; Domain 2
Homologous superfamily homologous superfamily	20 — Excisionase (Xis) protein

Domain ID domain_id	1rh6B00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1660 — Multidrug-efflux Transporter Regulator; Chain: A; Domain 2
Homologous superfamily homologous superfamily	20 — Excisionase (Xis) protein

▶

Unit-cell length a length_a	80.215 Å
Unit-cell length b length_b	72.691 Å
Unit-cell length c length_c	38.801 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	104.11 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.700 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.1929
R_work r_work	0.1912
R_free r_free	0.2255

Bacteriophage Lambda Excisionase (Xis)-DNA Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Excisionase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1rh6__assembly_2__model_1

1rh6__assembly_2__model_1 | I(q)

1rh6__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Bacteriophage Lambda Excisionase (Xis)-DNA Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Excisionase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1rh6__assembly_2__model_1

1rh6__assembly_2__model_1 | I(q)

1rh6__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)