1s4d

Crystal Structure Analysis of the S-adenosyl-L-methionine dependent uroporphyrinogen-III C-methyltransferase SUMT

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Uroporphyrin-III C-methyltransferase

Pseudomonas denitrificans

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	S-ADENOSYL-L-HOMOCYSTEINE × 2 GLYCEROL × 4 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	S-ADENOSYL-L-HOMOCYSTEINE × 2 GLYCEROL × 5 water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	S-ADENOSYL-L-HOMOCYSTEINE × 2 GLYCEROL × 5 water × 2	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 2	S-ADENOSYL-L-HOMOCYSTEINE × 2 GLYCEROL × 4 water × 2	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 2	S-ADENOSYL-L-HOMOCYSTEINE × 2 GLYCEROL × 5 water × 2	Consistent with protein count
6	Protein homooligomer	Homooligomer	Protein 2	S-ADENOSYL-L-HOMOCYSTEINE × 2 GLYCEROL × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SUMT_PSEDE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–280； UniProt 1–280 Author chain B； PDBConstruct 1–280； UniProt 1–280 Author chain D； PDBConstruct 1–280； UniProt 1–280 Author chain E； PDBConstruct 1–280； UniProt 1–280 Author chain F； PDBConstruct 1–280； UniProt 1–280 Author chain G； PDBConstruct 1–280； UniProt 1–280 Author chain H； PDBConstruct 1–280； UniProt 1–280 Author chain I； PDBConstruct 1–280； UniProt 1–280 Author chain J； PDBConstruct 1–280； UniProt 1–280 Author chain K； PDBConstruct 1–280； UniProt 1–280 Author chain L； PDBConstruct 1–280； UniProt 1–280 Author chain M； PDBConstruct 1–280； UniProt 1–280

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1s4d
Deposition date deposition_date	2004-01-16
Structure title title	Crystal Structure Analysis of the S-adenosyl-L-methionine dependent uroporphyrinogen-III C-methyltransferase SUMT
Keywords keywords	tetrapyrrole biosynthesis, cobalamin, SAM, SAH, uroporphyrinogen-III methyltransferase, Transferase; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1s4d__assembly_5__model_1

Assembly 5 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1s4d__assembly_5__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1s4d__assembly_5__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.04 Å
Rg (electron density)	21.67 Å
Total Rg	22.60 Å
Atom count	3798
Residues	510
Excluded volume	67880 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1s4d__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1s4d__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1s4d__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1s4d__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`1s4d__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`1s4d__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Uroporphyrin-III C-methyltransferase
Molecular weight formula_weight	29286.8 kDa
EC 编号 ec_number	2.1.1.107
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,D,E,F,G,H,I,J,K,L,M
Atom count atom_count	23427

MIDDLFAGLPALEKGSVWLVGAGPGDPGLLTLHAANALRQADVIVHDALVNEDCLKLARPGAVLEFAGKRGGKPSPKQRDISLRLVELARAGNRVLRLKGGDPFVFGRGGEEALTLVEHQVPFRIVPGITAGIGGLAYAGIPVTHREVNHAVTFLTGHDSSGLVPDRINWQGIASGSPVIVMYMAMKHIGAITANLIAGGRSPDEPVAFVCNAATPQQAVLETTLARAEADVAAAGLEPPAIVVVGEVVRLRAALDWIGALDGRKLAADPFANRILRNPA

Source Source

Source organism organism	Pseudomonas denitrificans
NCBI taxonomy ID ncbi_taxonomy_id	43306
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	S-ADENOSYL-L-HOMOCYSTEINE
Molecular weight formula_weight	384.4 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	26

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	523

▼

6. Fold Classification (SCOP + CATH) 36 domains

SCOP 2.08 (12 domains)

Domain ID domain_id	d1s4da_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.90 — Tetrapyrrole methylase
Superfamily Superfamily superfamily	c.90.1 — Tetrapyrrole methylase
Family Family family	c.90.1.1 — Tetrapyrrole methylase

Domain ID domain_id	d1s4db_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.90 — Tetrapyrrole methylase
Superfamily Superfamily superfamily	c.90.1 — Tetrapyrrole methylase
Family Family family	c.90.1.1 — Tetrapyrrole methylase

Domain ID domain_id	d1s4dd_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.90 — Tetrapyrrole methylase
Superfamily Superfamily superfamily	c.90.1 — Tetrapyrrole methylase
Family Family family	c.90.1.1 — Tetrapyrrole methylase

Domain ID domain_id	d1s4de_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.90 — Tetrapyrrole methylase
Superfamily Superfamily superfamily	c.90.1 — Tetrapyrrole methylase
Family Family family	c.90.1.1 — Tetrapyrrole methylase

Domain ID domain_id	d1s4df_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.90 — Tetrapyrrole methylase
Superfamily Superfamily superfamily	c.90.1 — Tetrapyrrole methylase
Family Family family	c.90.1.1 — Tetrapyrrole methylase

Domain ID domain_id	d1s4dg_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.90 — Tetrapyrrole methylase
Superfamily Superfamily superfamily	c.90.1 — Tetrapyrrole methylase
Family Family family	c.90.1.1 — Tetrapyrrole methylase

Domain ID domain_id	d1s4dh_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.90 — Tetrapyrrole methylase
Superfamily Superfamily superfamily	c.90.1 — Tetrapyrrole methylase
Family Family family	c.90.1.1 — Tetrapyrrole methylase

Domain ID domain_id	d1s4di_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.90 — Tetrapyrrole methylase
Superfamily Superfamily superfamily	c.90.1 — Tetrapyrrole methylase
Family Family family	c.90.1.1 — Tetrapyrrole methylase

Domain ID domain_id	d1s4dj_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.90 — Tetrapyrrole methylase
Superfamily Superfamily superfamily	c.90.1 — Tetrapyrrole methylase
Family Family family	c.90.1.1 — Tetrapyrrole methylase

Domain ID domain_id	d1s4dk_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.90 — Tetrapyrrole methylase
Superfamily Superfamily superfamily	c.90.1 — Tetrapyrrole methylase
Family Family family	c.90.1.1 — Tetrapyrrole methylase

Domain ID domain_id	d1s4dl_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.90 — Tetrapyrrole methylase
Superfamily Superfamily superfamily	c.90.1 — Tetrapyrrole methylase
Family Family family	c.90.1.1 — Tetrapyrrole methylase

Domain ID domain_id	d1s4dm_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.90 — Tetrapyrrole methylase
Superfamily Superfamily superfamily	c.90.1 — Tetrapyrrole methylase
Family Family family	c.90.1.1 — Tetrapyrrole methylase

CATH v4.4 (24 domains)

Domain ID domain_id	1s4dA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1010 — Cobalt-precorrin-4 Transmethylase; domain 1
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, N-terminal domain

Domain ID domain_id	1s4dA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	950 — Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, C-terminal domain

Domain ID domain_id	1s4dB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1010 — Cobalt-precorrin-4 Transmethylase; domain 1
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, N-terminal domain

Domain ID domain_id	1s4dB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	950 — Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, C-terminal domain

Domain ID domain_id	1s4dD01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1010 — Cobalt-precorrin-4 Transmethylase; domain 1
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, N-terminal domain

Domain ID domain_id	1s4dD02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	950 — Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, C-terminal domain

Domain ID domain_id	1s4dE01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1010 — Cobalt-precorrin-4 Transmethylase; domain 1
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, N-terminal domain

Domain ID domain_id	1s4dE02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	950 — Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, C-terminal domain

Domain ID domain_id	1s4dF01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1010 — Cobalt-precorrin-4 Transmethylase; domain 1
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, N-terminal domain

Domain ID domain_id	1s4dF02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	950 — Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, C-terminal domain

Domain ID domain_id	1s4dG01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1010 — Cobalt-precorrin-4 Transmethylase; domain 1
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, N-terminal domain

Domain ID domain_id	1s4dG02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	950 — Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, C-terminal domain

Domain ID domain_id	1s4dH01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1010 — Cobalt-precorrin-4 Transmethylase; domain 1
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, N-terminal domain

Domain ID domain_id	1s4dH02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	950 — Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, C-terminal domain

Domain ID domain_id	1s4dI01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1010 — Cobalt-precorrin-4 Transmethylase; domain 1
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, N-terminal domain

Domain ID domain_id	1s4dI02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	950 — Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, C-terminal domain

Domain ID domain_id	1s4dJ01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1010 — Cobalt-precorrin-4 Transmethylase; domain 1
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, N-terminal domain

Domain ID domain_id	1s4dJ02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	950 — Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, C-terminal domain

Domain ID domain_id	1s4dK01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1010 — Cobalt-precorrin-4 Transmethylase; domain 1
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, N-terminal domain

Domain ID domain_id	1s4dK02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	950 — Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, C-terminal domain

Domain ID domain_id	1s4dL01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1010 — Cobalt-precorrin-4 Transmethylase; domain 1
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, N-terminal domain

Domain ID domain_id	1s4dL02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	950 — Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, C-terminal domain

Domain ID domain_id	1s4dM01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1010 — Cobalt-precorrin-4 Transmethylase; domain 1
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, N-terminal domain

Domain ID domain_id	1s4dM02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	950 — Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2
Homologous superfamily homologous superfamily	10 — Tetrapyrrole methylase, C-terminal domain

▶

Unit-cell length a length_a	218.097 Å
Unit-cell length b length_b	218.097 Å
Unit-cell length c length_c	190.341 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	96

Space group space_group	I 4
Space-group number int_tables_number	79
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	19.840 Å
R factor r_factor	0.2153
R_work r_work	0.2129
R_free r_free	0.2603

Crystal Structure Analysis of the S-adenosyl-L-methionine dependent uroporphyrinogen-III C-methyltransferase SUMT

1. Protein Identity and Related Structures Protein Identity & Related Structures

Uroporphyrin-III C-methyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1s4d__assembly_5__model_1

1s4d__assembly_5__model_1 | I(q)

1s4d__assembly_5__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 36 domains

SCOP 2.08 (12 domains)

CATH v4.4 (24 domains)

7. Citations (1)

Crystal Structure Analysis of the S-adenosyl-L-methionine dependent uroporphyrinogen-III C-methyltransferase SUMT

1. Protein Identity and Related Structures Protein Identity & Related Structures

Uroporphyrin-III C-methyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1s4d__assembly_5__model_1

1s4d__assembly_5__model_1 | I(q)

1s4d__assembly_5__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 36 domains

SCOP 2.08 (12 domains)

CATH v4.4 (24 domains)

7. Citations (1)