1sf8

Crystal structure of the carboxy-terminal domain of htpG, the E. coli Hsp90

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chaperone protein htpG

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	NICKEL (II) ION × 1 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	NICKEL (II) ION × 1 CHLORIDE ION × 1 water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	NICKEL (II) ION × 1 CHLORIDE ION × 1 water × 2	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 2	CHLORIDE ION × 1 water × 2	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 8	NICKEL (II) ION × 3 CHLORIDE ION × 3 water × 8	Consistent with protein count
6	Protein homooligomer	Homooligomer	Protein 4	NICKEL (II) ION × 2 CHLORIDE ION × 2 water × 4	Consistent with protein count
7	Protein homooligomer	Homooligomer	Protein 4	NICKEL (II) ION × 1 CHLORIDE ION × 1 water × 4	Consistent with protein count
8	Protein homooligomer	Homooligomer	Protein 4	NICKEL (II) ION × 1 CHLORIDE ION × 3 water × 4	Consistent with protein count
9	Protein homooligomer	Homooligomer	Protein 4	NICKEL (II) ION × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HTPG_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 13–126； UniProt 511–624 Author chain B； PDBConstruct 13–126； UniProt 511–624 Author chain C； PDBConstruct 13–126； UniProt 511–624 Author chain D； PDBConstruct 13–126； UniProt 511–624 Author chain E； PDBConstruct 13–126； UniProt 511–624 Author chain F； PDBConstruct 13–126； UniProt 511–624 Author chain G； PDBConstruct 13–126； UniProt 511–624 Author chain H； PDBConstruct 13–126； UniProt 511–624

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1sf8
Deposition date deposition_date	2004-02-19
Structure title title	Crystal structure of the carboxy-terminal domain of htpG, the E. coli Hsp90
Keywords keywords	four helix bundle dimerization interface, exposed amphipathic helix, three stranded beta sheet, CHAPERONE; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1sf8__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1sf8__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1sf8__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.54 Å
Rg (electron density)	19.35 Å
Total Rg	20.33 Å
Atom count	1834
Residues	224
Excluded volume	32935 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1sf8__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1sf8__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1sf8__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1sf8__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`1sf8__assembly_5__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`1sf8__assembly_6__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`1sf8__assembly_7__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`1sf8__assembly_8__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`1sf8__assembly_9__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Chaperone protein htpG
Molecular weight formula_weight	14501.1 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H
Atom count atom_count	7915

MRGSHHHHHHGSFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEVKYIFELNPDHVLVKRAADTEDEAKFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	NICKEL (II) ION
Molecular weight formula_weight	58.7 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	484

▼

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (16 domains)

Domain ID domain_id	d1sf8a1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.271 — HSP90 C-terminal domain
Superfamily Superfamily superfamily	d.271.1 — HSP90 C-terminal domain
Family Family family	d.271.1.1 — HSP90 C-terminal domain

Domain ID domain_id	d1sf8a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1sf8b1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.271 — HSP90 C-terminal domain
Superfamily Superfamily superfamily	d.271.1 — HSP90 C-terminal domain
Family Family family	d.271.1.1 — HSP90 C-terminal domain

Domain ID domain_id	d1sf8b2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1sf8c1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.271 — HSP90 C-terminal domain
Superfamily Superfamily superfamily	d.271.1 — HSP90 C-terminal domain
Family Family family	d.271.1.1 — HSP90 C-terminal domain

Domain ID domain_id	d1sf8c2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1sf8d1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.271 — HSP90 C-terminal domain
Superfamily Superfamily superfamily	d.271.1 — HSP90 C-terminal domain
Family Family family	d.271.1.1 — HSP90 C-terminal domain

Domain ID domain_id	d1sf8d2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1sf8e1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.271 — HSP90 C-terminal domain
Superfamily Superfamily superfamily	d.271.1 — HSP90 C-terminal domain
Family Family family	d.271.1.1 — HSP90 C-terminal domain

Domain ID domain_id	d1sf8e2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1sf8f1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.271 — HSP90 C-terminal domain
Superfamily Superfamily superfamily	d.271.1 — HSP90 C-terminal domain
Family Family family	d.271.1.1 — HSP90 C-terminal domain

Domain ID domain_id	d1sf8f2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1sf8g1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.271 — HSP90 C-terminal domain
Superfamily Superfamily superfamily	d.271.1 — HSP90 C-terminal domain
Family Family family	d.271.1.1 — HSP90 C-terminal domain

Domain ID domain_id	d1sf8g2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1sf8h1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.271 — HSP90 C-terminal domain
Superfamily Superfamily superfamily	d.271.1 — HSP90 C-terminal domain
Family Family family	d.271.1.1 — HSP90 C-terminal domain

Domain ID domain_id	d1sf8h2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (8 domains)

Domain ID domain_id	1sf8A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	790 — Heat shock protein 90, C-terminal domain

Domain ID domain_id	1sf8B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	790 — Heat shock protein 90, C-terminal domain

Domain ID domain_id	1sf8C00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	790 — Heat shock protein 90, C-terminal domain

Domain ID domain_id	1sf8D00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	790 — Heat shock protein 90, C-terminal domain

Domain ID domain_id	1sf8E00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	790 — Heat shock protein 90, C-terminal domain

Domain ID domain_id	1sf8F00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	790 — Heat shock protein 90, C-terminal domain

Domain ID domain_id	1sf8G00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	790 — Heat shock protein 90, C-terminal domain

Domain ID domain_id	1sf8H00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	790 — Heat shock protein 90, C-terminal domain

▶

Unit-cell length a length_a	103.516 Å
Unit-cell length b length_b	103.516 Å
Unit-cell length c length_c	249.738 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	64

Space group space_group	P 43 21 2
Space-group number int_tables_number	96
Crystal system crystal_system	—

Resolution resolution	2.600 Å
Low-resolution limit resolution_low	29.900 Å
R factor r_factor	0.2250
R_work r_work	0.2230
R_free r_free	0.2610

Crystal structure of the carboxy-terminal domain of htpG, the E. coli Hsp90

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chaperone protein htpG

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1sf8__assembly_3__model_1

1sf8__assembly_3__model_1 | I(q)

1sf8__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (16 domains)

CATH v4.4 (8 domains)

7. Citations (1)

Crystal structure of the carboxy-terminal domain of htpG, the E. coli Hsp90

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chaperone protein htpG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1sf8__assembly_3__model_1

1sf8__assembly_3__model_1 | I(q)

1sf8__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (16 domains)

CATH v4.4 (8 domains)

7. Citations (1)