1tue

The X-ray Structure of the Papillomavirus Helicase in Complex with its Molecular Matchmaker E2

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Replication protein E1

Human papillomavirus type 18

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Regulatory protein E2 × 1 （Q80B71） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Regulatory protein E2 × 1 （Q80B71） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Regulatory protein E2 × 1 （Q80B71） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Regulatory protein E2 × 1 （Q80B71） water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Regulatory protein E2 × 1 （Q80B71） water × 2	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Regulatory protein E2 × 1 （Q80B71） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VE1_HPV18
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 9–212； UniProt 428–631 Author chain D； PDBConstruct 9–212； UniProt 428–631 Author chain F； PDBConstruct 9–212； UniProt 428–631 Author chain H； PDBConstruct 9–212； UniProt 428–631 Author chain K； PDBConstruct 9–212； UniProt 428–631 Author chain M； PDBConstruct 9–212； UniProt 428–631

Regulatory protein E2

Human papillomavirus type 18

UniProt Q80B71

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Replication protein E1 × 1 （P06789） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Replication protein E1 × 1 （P06789） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Replication protein E1 × 1 （P06789） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Replication protein E1 × 1 （P06789） water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Replication protein E1 × 1 （P06789） water × 2	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Replication protein E1 × 1 （P06789） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q80B71_HPV18
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 4–218； UniProt 1–215 Author chain E； PDBConstruct 4–218； UniProt 1–215 Author chain G； PDBConstruct 4–218； UniProt 1–215 Author chain J； PDBConstruct 4–218； UniProt 1–215 Author chain L； PDBConstruct 4–218； UniProt 1–215 Author chain Q； PDBConstruct 4–218； UniProt 1–215

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1tue
Deposition date deposition_date	2004-06-24
Structure title title	The X-ray Structure of the Papillomavirus Helicase in Complex with its Molecular Matchmaker E2
Keywords keywords	Human papillomavirus, helicase, replication, E1E2 complex, AAA+ protein; REPLICATION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1tue__assembly_5__model_1

Assembly 5 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1tue__assembly_5__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1tue__assembly_5__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.69 Å
Rg (electron density)	22.38 Å
Total Rg	23.31 Å
Atom count	3168
Residues	385
Excluded volume	56142 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1tue__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1tue__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1tue__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1tue__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`1tue__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`1tue__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Replication protein E1
Molecular weight formula_weight	24617.1 kDa
Mutation mutation	C14A,V15L,R90A
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,F,H,K,M
Atom count atom_count	20186

GSEFGSGSNMSQWIRFRCSKIDEGGDWRPIVQFLRYQQIEFITFLGALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFVNSTSHFWLEPLTDTKVAMLDDATTTCWTYFDTYMRNALDGNPISIDRKHKPLIQLKCPPILLTTNIHPAKDNRWPYLESRITVFEFPNAFPFDKNGNPVYEINDKNWKCFFERTWSRLDLHE

Source Source

Source organism organism	Human papillomavirus type 18
NCBI taxonomy ID ncbi_taxonomy_id	333761
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Regulatory protein E2
Molecular weight formula_weight	25085.7 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,G,J,L,Q

GSHMQTPKETLSERLSALQDKIIDHYENDSKDIDSQIQYWQLIRWENAIFFAAREHGIQTLNHQVVPAYNISKSKAHKAIELQMALQGLAQSAYKTEDWTLQDTCEELWNTEPTHCFKKGGQTVQVYFDGNKDNCMTYVAWDSVYYMTDAGTWDKTATCVSHRGLYYVKEGYNTFYIEFKSECEKYGNTGTWEVHFGNNVIDCNDSMCSTSDDTVSAT

Source Source

Source organism organism	Human papillomavirus type 18
NCBI taxonomy ID ncbi_taxonomy_id	333761
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	969

▼

6. Fold Classification (SCOP + CATH) 32 domains

SCOP 2.08 (14 domains)

Domain ID domain_id	d1tuea1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.20 — Extended AAA-ATPase domain

Domain ID domain_id	d1tuea2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1tueb1
Class class	b — All beta proteins
Fold Fold fold	b.91 — E2 regulatory, transactivation domain
Superfamily Superfamily superfamily	b.91.1 — E2 regulatory, transactivation domain
Family Family family	b.91.1.1 — E2 regulatory, transactivation domain

Domain ID domain_id	d1tueb2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1tued_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.20 — Extended AAA-ATPase domain

Domain ID domain_id	d1tuee_
Class class	b — All beta proteins
Fold Fold fold	b.91 — E2 regulatory, transactivation domain
Superfamily Superfamily superfamily	b.91.1 — E2 regulatory, transactivation domain
Family Family family	b.91.1.1 — E2 regulatory, transactivation domain

Domain ID domain_id	d1tuef_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.20 — Extended AAA-ATPase domain

Domain ID domain_id	d1tueg_
Class class	b — All beta proteins
Fold Fold fold	b.91 — E2 regulatory, transactivation domain
Superfamily Superfamily superfamily	b.91.1 — E2 regulatory, transactivation domain
Family Family family	b.91.1.1 — E2 regulatory, transactivation domain

Domain ID domain_id	d1tueh_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.20 — Extended AAA-ATPase domain

Domain ID domain_id	d1tuej_
Class class	b — All beta proteins
Fold Fold fold	b.91 — E2 regulatory, transactivation domain
Superfamily Superfamily superfamily	b.91.1 — E2 regulatory, transactivation domain
Family Family family	b.91.1.1 — E2 regulatory, transactivation domain

Domain ID domain_id	d1tuek_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.20 — Extended AAA-ATPase domain

Domain ID domain_id	d1tuel_
Class class	b — All beta proteins
Fold Fold fold	b.91 — E2 regulatory, transactivation domain
Superfamily Superfamily superfamily	b.91.1 — E2 regulatory, transactivation domain
Family Family family	b.91.1.1 — E2 regulatory, transactivation domain

Domain ID domain_id	d1tuem_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.20 — Extended AAA-ATPase domain

Domain ID domain_id	d1tueq_
Class class	b — All beta proteins
Fold Fold fold	b.91 — E2 regulatory, transactivation domain
Superfamily Superfamily superfamily	b.91.1 — E2 regulatory, transactivation domain
Family Family family	b.91.1.1 — E2 regulatory, transactivation domain

CATH v4.4 (18 domains)

Domain ID domain_id	1tueA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	1tueB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	30 — E2 (early) protein, N terminal domain, subdomain 1

Domain ID domain_id	1tueB02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	200 — Regulatory Protein E2; Chain: A; Domain 2
Homologous superfamily homologous superfamily	10 — Papillomavirus E2 early protein domain

Domain ID domain_id	1tueD00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	1tueE01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	30 — E2 (early) protein, N terminal domain, subdomain 1

Domain ID domain_id	1tueE02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	200 — Regulatory Protein E2; Chain: A; Domain 2
Homologous superfamily homologous superfamily	10 — Papillomavirus E2 early protein domain

Domain ID domain_id	1tueF00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	1tueG01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	30 — E2 (early) protein, N terminal domain, subdomain 1

Domain ID domain_id	1tueG02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	200 — Regulatory Protein E2; Chain: A; Domain 2
Homologous superfamily homologous superfamily	10 — Papillomavirus E2 early protein domain

Domain ID domain_id	1tueH00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	1tueJ01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	30 — E2 (early) protein, N terminal domain, subdomain 1

Domain ID domain_id	1tueJ02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	200 — Regulatory Protein E2; Chain: A; Domain 2
Homologous superfamily homologous superfamily	10 — Papillomavirus E2 early protein domain

Domain ID domain_id	1tueK00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	1tueL01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	30 — E2 (early) protein, N terminal domain, subdomain 1

Domain ID domain_id	1tueL02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	200 — Regulatory Protein E2; Chain: A; Domain 2
Homologous superfamily homologous superfamily	10 — Papillomavirus E2 early protein domain

Domain ID domain_id	1tueM00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	1tueQ01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	30 — E2 (early) protein, N terminal domain, subdomain 1

Domain ID domain_id	1tueQ02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	200 — Regulatory Protein E2; Chain: A; Domain 2
Homologous superfamily homologous superfamily	10 — Papillomavirus E2 early protein domain

▶

Unit-cell length a length_a	82.297 Å
Unit-cell length b length_b	88.745 Å
Unit-cell length c length_c	375.027 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2210
R_work r_work	0.2188
R_free r_free	0.2625

The X-ray Structure of the Papillomavirus Helicase in Complex with its Molecular Matchmaker E2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Replication protein E1

State in the Current Structure

Other States of the Same Protein in the Database

Regulatory protein E2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1tue__assembly_5__model_1

1tue__assembly_5__model_1 | I(q)

1tue__assembly_5__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 32 domains

SCOP 2.08 (14 domains)

CATH v4.4 (18 domains)

7. Citations (1)

The X-ray Structure of the Papillomavirus Helicase in Complex with its Molecular Matchmaker E2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Replication protein E1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Regulatory protein E2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1tue__assembly_5__model_1

1tue__assembly_5__model_1 | I(q)

1tue__assembly_5__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 32 domains

SCOP 2.08 (14 domains)

CATH v4.4 (18 domains)

7. Citations (1)