SAXSdb — 1tyg

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

yjbS

Bacillus subtilis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Thiazole biosynthesis protein thiG × 4 （O31618） PHOSPHATE ION × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O31617_BACSU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 22–87； UniProt 1–66 Author chain G； PDBConstruct 22–87； UniProt 1–66

Thiazole biosynthesis protein thiG

Bacillus subtilis

UniProt O31618

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	yjbS × 4 （O31617） PHOSPHATE ION × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	THIG_BACSU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–253； UniProt 3–255 Author chain C； PDBConstruct 1–253； UniProt 3–255

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1tyg
Deposition date deposition_date	2004-07-07
Structure title title	Structure of the thiazole synthase/ThiS complex
Keywords keywords	alpha beta barrel, protein-protein complex, ThiS, ThiG, BIOSYNTHETIC PROTEIN; BIOSYNTHETIC PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1tyg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1tyg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1tyg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	38.26 Å
Rg (electron density)	37.74 Å
Total Rg	37.96 Å
Atom count	9100
Residues	1216
Excluded volume	163440 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1tyg__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	yjbS
Molecular weight formula_weight	10099.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,G
Atom count atom_count	4555

MGHHHHHHHHHHSSGHIGGRHMLQLNGKDVKWKKDTGTIQDLLASYQLENKIVIVERNKEIIGKERYHEVELCDRDVIEIVHFVGGG

Source Source

Source organism organism	Bacillus subtilis
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Thiazole biosynthesis protein thiG
Molecular weight formula_weight	26728.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C

MLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRMNIFEASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDMIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAIMPGASPIGSGQGILNPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGRLSYEAGRIPLKQYGTASSPGEGLP

Source Source

Source organism organism	Bacillus subtilis
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	5

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1tyga_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.1 — TIM beta/alpha-barrel
Superfamily Superfamily superfamily	c.1.31 — ThiG-like
Family Family family	c.1.31.1 — ThiG-like

Domain ID domain_id	d1tygb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.15 — beta-Grasp (ubiquitin-like)
Superfamily Superfamily superfamily	d.15.3 — MoaD/ThiS
Family Family family	d.15.3.2 — ThiS

Domain ID domain_id	d1tygc_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.1 — TIM beta/alpha-barrel
Superfamily Superfamily superfamily	c.1.31 — ThiG-like
Family Family family	c.1.31.1 — ThiG-like

Domain ID domain_id	d1tygg_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.15 — beta-Grasp (ubiquitin-like)
Superfamily Superfamily superfamily	d.15.3 — MoaD/ThiS
Family Family family	d.15.3.2 — ThiS

CATH v4.4 (4 domains)

Domain ID domain_id	1tygA00
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	70 — Aldolase class I

Domain ID domain_id	1tygB00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	30 — Beta-grasp domain

Domain ID domain_id	1tygC00
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	70 — Aldolase class I

Domain ID domain_id	1tygG00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	30 — Beta-grasp domain

▶

Unit-cell length a length_a	91.654 Å
Unit-cell length b length_b	91.654 Å
Unit-cell length c length_c	401.300 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 65 2 2
Space-group number int_tables_number	179
Crystal system crystal_system	—

Resolution resolution	3.150 Å
Low-resolution limit resolution_low	15.000 Å
R factor r_factor	0.2469
R_work r_work	0.2423
R_free r_free	0.3046

Structure of the thiazole synthase/ThiS complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

yjbS

State in the Current Structure

Other States of the Same Protein in the Database

Thiazole biosynthesis protein thiG

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1tyg__assembly_1__model_1

1tyg__assembly_1__model_1 | I(q)

1tyg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Structure of the thiazole synthase/ThiS complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

yjbS

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Thiazole biosynthesis protein thiG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1tyg__assembly_1__model_1

1tyg__assembly_1__model_1 | I(q)

1tyg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)