1v4l

Crystal structure of a platelet agglutination factor isolated from the venom of Taiwan habu (Trimeresurus mucrosquamatus)

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

mucrocetin alpha chain

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	mucrocetin beta chain × 12 （Q6TPG9） water × 24	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	mucrocetin beta chain × 1 （Q6TPG9） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	mucrocetin beta chain × 1 （Q6TPG9） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	mucrocetin beta chain × 1 （Q6TPG9） water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 16	mucrocetin beta chain × 8 （Q6TPG9） water × 16	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 16	mucrocetin beta chain × 8 （Q6TPG9） water × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6TPH0_TRIMU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–135； UniProt 24–158 Author chain C； PDBConstruct 1–135； UniProt 24–158 Author chain E； PDBConstruct 1–135； UniProt 24–158

mucrocetin beta chain

OrganismNot specified

UniProt Q6TPG9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	mucrocetin alpha chain × 12 （Q6TPH0） water × 24	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	mucrocetin alpha chain × 1 （Q6TPH0） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	mucrocetin alpha chain × 1 （Q6TPH0） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	mucrocetin alpha chain × 1 （Q6TPH0） water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 16	mucrocetin alpha chain × 8 （Q6TPH0） water × 16	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 16	mucrocetin alpha chain × 8 （Q6TPH0） water × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6TPG9_TRIMU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–125； UniProt 24–148 Author chain D； PDBConstruct 1–125； UniProt 24–148 Author chain F； PDBConstruct 1–125； UniProt 24–148

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1v4l
Deposition date deposition_date	2003-11-14
Structure title title	Crystal structure of a platelet agglutination factor isolated from the venom of Taiwan habu (Trimeresurus mucrosquamatus)
Keywords keywords	lectin-like, square-shaped ring, BLOOD CLOTTING; BLOOD CLOTTING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1v4l__assembly_5__model_1

Assembly 5 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1v4l__assembly_5__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1v4l__assembly_5__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.00 Å
Rg (electron density)	50.77 Å
Total Rg	51.11 Å
Atom count	17016
Residues	2080
Excluded volume	298310 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1v4l__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1v4l__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1v4l__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1v4l__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`1v4l__assembly_5__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`1v4l__assembly_6__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	mucrocetin alpha chain
Molecular weight formula_weight	15745.5 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E
Atom count atom_count	6917

DFDCIPGWSAYDRYCYQAFSEPKNWEDAESFCEEGVKTSHLVSIESSGEGDFVAQLVAEKIKTSFQYVWIGLRIQNKEQQCRSEWSDASSVNYENLYKQSSKKCYALKKGTELRTWFNVYCGRENPFVCKYTPEC

Entity 2 Entity 2 polymer

Description description	mucrocetin beta chain
Molecular weight formula_weight	14559.2 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F

GFCCPLGWSSYDEHCYQVFQQKMNWEDAEKFCTQQHRGSHLVSFHSSEEVDFVVSKTSPILKHDFVWMGLSNVWNECAKEWSDGTKLDYKAWSGQSDCITSKTTDNQWLSMDCSSKRYVVCKFQA

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	536

▼

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d1v4la_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d1v4lb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d1v4lc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d1v4ld_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d1v4le_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d1v4lf_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

CATH v4.4 (6 domains)

Domain ID domain_id	1v4lA00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	1v4lB00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	1v4lC00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	1v4lD00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	1v4lE00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	1v4lF00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

▶

Unit-cell length a length_a	119.866 Å
Unit-cell length b length_b	119.866 Å
Unit-cell length c length_c	360.815 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	I 4 2 2
Space-group number int_tables_number	97
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	18.000 Å
R factor r_factor	—
R_work r_work	0.2350
R_free r_free	0.2980

Crystal structure of a platelet agglutination factor isolated from the venom of Taiwan habu (Trimeresurus mucrosquamatus)

1. Protein Identity and Related Structures Protein Identity & Related Structures

mucrocetin alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

mucrocetin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1v4l__assembly_5__model_1

1v4l__assembly_5__model_1 | I(q)

1v4l__assembly_5__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

CATH v4.4 (6 domains)

7. Citations (1)

Crystal structure of a platelet agglutination factor isolated from the venom of Taiwan habu (Trimeresurus mucrosquamatus)

1. Protein Identity and Related Structures Protein Identity & Related Structures

mucrocetin alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

mucrocetin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1v4l__assembly_5__model_1

1v4l__assembly_5__model_1 | I(q)

1v4l__assembly_5__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

CATH v4.4 (6 domains)

7. Citations (1)