SAXSdb — 1vra

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Arginine biosynthesis bifunctional protein argJ

Bacillus halodurans

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 2 UNKNOWN LIGAND × 1 1,2-ETHANEDIOL × 16 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 4	SULFATE ION × 4 UNKNOWN LIGAND × 2 1,2-ETHANEDIOL × 32 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARGJ_BACHD
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 13–208； UniProt 1–196 Author chain B； PDBConstruct 1–215； UniProt 197–411

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1vra
Deposition date deposition_date	2005-02-17
Structure title title	Crystal structure of Arginine biosynthesis bifunctional protein argJ (10175521) from Bacillus halodurans at 2.00 A resolution
Keywords keywords	;10175521, arginine biosynthesis bifunctional protein argJ, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, TRANSFERASE ;; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1vra__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1vra__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1vra__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.72 Å
Rg (electron density)	29.32 Å
Total Rg	29.77 Å
Atom count	6096
Residues	790
Excluded volume	108470 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1vra__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1vra__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Arginine biosynthesis bifunctional protein argJ
Molecular weight formula_weight	22350.5 kDa
EC 编号 ec_number	2.3.1.35, 2.3.1.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3498

MGSDKIHHHHHHMNVINETANVLKLETGSVTSAKGFSAVGIHTGVKRKRKDLGAIVCEVPASSAAVYTLNKVQAAPLKVTQESIAVEGKLQAMIVNSGIANACTGKRGLDDAYTMRAVGAETFHIPEHYVAVTSTGVIGEFLPMDVITNGIRQLKPEATIEGAHAFNEAILTTDTVEKHTCYQTIVNGKTVTVGGVAKGSGMIHPNMA

Source Source

Source organism organism	Bacillus halodurans
NCBI taxonomy ID ncbi_taxonomy_id	86665
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Arginine biosynthesis bifunctional protein argJ
Molecular weight formula_weight	23196.1 kDa
EC 编号 ec_number	2.3.1.35, 2.3.1.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

TMLSFVTTDANIDHGHLQGALSAITNETFNRITVDGDTSTNDMVVVMASGLAENETLTPEHPDWANFYKALQLACEDLAKQIARDGEGATKLIEVEVTGAANDQEAGMVAKQIVGSDLVKTAIYGADANWGRIICAIGYSGCEVNQETIDIAIGPIVTLKQSEPTGFSEEEATAYLKEADPVKISVNLHIGNGTGKAWGCDLTYDYVRINAGYRT

Source Source

Source organism organism	Bacillus halodurans
NCBI taxonomy ID ncbi_taxonomy_id	86665
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	UNKNOWN LIGAND
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	388

▼

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	1vraA00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	70 — L-amino peptidase D-ALA esterase/amidase
Homologous superfamily homologous superfamily	12 — L-amino peptidase D-ALA esterase/amidase

Domain ID domain_id	1vraB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2330 — arginine biosynthesis bifunctional protein fold
Homologous superfamily homologous superfamily	10 — arginine biosynthesis bifunctional protein suprefamily

Domain ID domain_id	1vraB02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	340 — ArgJ beta chain, C-terminal domain

▶

Unit-cell length a length_a	70.658 Å
Unit-cell length b length_b	70.658 Å
Unit-cell length c length_c	222.292 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	29.810 Å
R factor r_factor	0.1406
R_work r_work	0.1397
R_free r_free	0.1578

Crystal structure of Arginine biosynthesis bifunctional protein argJ (10175521) from Bacillus halodurans at 2.00 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Arginine biosynthesis bifunctional protein argJ

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1vra__assembly_2__model_1

1vra__assembly_2__model_1 | I(q)

1vra__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

7. Citations (1)

Crystal structure of Arginine biosynthesis bifunctional protein argJ (10175521) from Bacillus halodurans at 2.00 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Arginine biosynthesis bifunctional protein argJ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1vra__assembly_2__model_1

1vra__assembly_2__model_1 | I(q)

1vra__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

7. Citations (1)