SAXSdb — 1wuw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Beta-hordothionin

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	PARA-TOLUENE SULFONATE × 2 SERINE × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	THNB_HORVU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–45； UniProt 28–72 Author chain B； PDBConstruct 1–45； UniProt 28–72

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1wuw
Deposition date deposition_date	2004-12-09
Structure title title	Crystal Structure of beta hordothionin
Keywords keywords	crambin fold, dimer, PLANT PROTEIN; PLANT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1wuw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1wuw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1wuw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	13.95 Å
Rg (electron density)	13.59 Å
Total Rg	14.62 Å
Atom count	710
Residues	90
Excluded volume	12670 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1wuw__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Beta-hordothionin
Molecular weight formula_weight	4936.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	824

KSCCRSTLGRNCYNLCRVRGAQKLCANACRCKLTSGLKCPSSFPK

Entity 2 Entity 2 non-polymer

Description description	PARA-TOLUENE SULFONATE
Molecular weight formula_weight	172.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	SERINE
Molecular weight formula_weight	105.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	92

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d1wuwa_
Class class	g — Small proteins
Fold Fold fold	g.13 — Crambin-like
Superfamily Superfamily superfamily	g.13.1 — Crambin-like
Family Family family	g.13.1.1 — Crambin-like

Domain ID domain_id	d1wuwb_
Class class	g — Small proteins
Fold Fold fold	g.13 — Crambin-like
Superfamily Superfamily superfamily	g.13.1 — Crambin-like
Family Family family	g.13.1.1 — Crambin-like

CATH v4.4 (2 domains)

Domain ID domain_id	1wuwA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1350 — Crambin
Homologous superfamily homologous superfamily	10 — Thionin-like

Domain ID domain_id	1wuwB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1350 — Crambin
Homologous superfamily homologous superfamily	10 — Thionin-like

▶

Unit-cell length a length_a	68.660 Å
Unit-cell length b length_b	68.660 Å
Unit-cell length c length_c	47.470 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.1720
R_work r_work	0.1720
R_free r_free	0.2120

Crystal Structure of beta hordothionin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Beta-hordothionin

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1wuw__assembly_1__model_1

1wuw__assembly_1__model_1 | I(q)

1wuw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Crystal Structure of beta hordothionin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Beta-hordothionin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1wuw__assembly_1__model_1

1wuw__assembly_1__model_1 | I(q)

1wuw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)