SAXSdb — 1wx5

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

tyrosinase

Streptomyces castaneoglobisporus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	MelC × 1 （Q83WS1） SODIUM ION × 1 CHLORIDE ION × 2 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	MelC × 1 （Q83WS1） SODIUM ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q83WS2_9ACTO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–273； UniProt 1–273 Author chain C； PDBConstruct 1–273； UniProt 1–273

MelC

Streptomyces castaneoglobisporus

UniProt Q83WS1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	tyrosinase × 1 （Q83WS2） SODIUM ION × 1 CHLORIDE ION × 2 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	tyrosinase × 1 （Q83WS2） SODIUM ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q83WS1_9ACTO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–126； UniProt 1–126 Author chain D； PDBConstruct 1–126； UniProt 1–126

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1wx5
Deposition date deposition_date	2005-01-19
Structure title title	Crystal Structure of the copper-free Streptomyces castaneoglobisporus tyrosinase complexed with a caddie protein in the monoclinic crystal
Keywords keywords	tyrosinase, binary complex, flexibility, OXIDOREDUCTASE-METAL TRANSPORT COMPLEX; OXIDOREDUCTASE/METAL TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1wx5__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1wx5__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1wx5__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.38 Å
Rg (electron density)	19.29 Å
Total Rg	20.26 Å
Atom count	2768
Residues	348
Excluded volume	48376 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1wx5__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1wx5__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	tyrosinase
Molecular weight formula_weight	32089.6 kDa
EC 编号 ec_number	1.14.18.1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	6027

MTVRKNQATLTADEKRRFVAAVLELKRSGRYDEFVRTHNEFIMSDTDSGERTGHRSPSFLPWHRRFLLDFEQALQSVDSSVTLPYWDWSADRTVRASLWAPDFLGGTGRSTDGRVMDGPFAASTGNWPINVRVDSRTYLRRSLGGSVAELPTRAEVESVLAISAYDLPPYNSASEGFRNHLEGWRGVNLHNRVHVWVGGQMATGVSPNDPVFWLHHAYVDKLWAEWQRRHPDSAYVPTGGTPDVVDLNETMKPWNTVRPADLLDHTAYYTFDALEHHHHHH

Source Source

Source organism organism	Streptomyces castaneoglobisporus
NCBI taxonomy ID ncbi_taxonomy_id	79261
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	MelC
Molecular weight formula_weight	14203.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

MPEITRRRALTAAAAVAATASAAVTLAAPAASAAGHHEPAAPESFDEVYKGRRIQGRPARGAAHHHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLPFPANLEHHHHHH

Source Source

Source organism organism	Streptomyces castaneoglobisporus
NCBI taxonomy ID ncbi_taxonomy_id	79261
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	498

▼

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d1wx5a1
Class class	a — All alpha proteins
Fold Fold fold	a.86 — Di-copper centre-containing domain
Superfamily Superfamily superfamily	a.86.1 — Di-copper centre-containing domain
Family Family family	a.86.1.3 — Tyrosinase

Domain ID domain_id	d1wx5a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1wx5b_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.386 — Tyrosinase cofactor MelC1-like
Superfamily Superfamily superfamily	d.386.1 — Tyrosinase cofactor MelC1
Family Family family	d.386.1.1 — Tyrosinase cofactor MelC1

Domain ID domain_id	d1wx5c1
Class class	a — All alpha proteins
Fold Fold fold	a.86 — Di-copper centre-containing domain
Superfamily Superfamily superfamily	a.86.1 — Di-copper centre-containing domain
Family Family family	a.86.1.3 — Tyrosinase

Domain ID domain_id	d1wx5c2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1wx5d_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.386 — Tyrosinase cofactor MelC1-like
Superfamily Superfamily superfamily	d.386.1 — Tyrosinase cofactor MelC1
Family Family family	d.386.1.1 — Tyrosinase cofactor MelC1

CATH v4.4 (4 domains)

Domain ID domain_id	1wx5A00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1280 — di-copper center containing domain from catechol oxidase
Homologous superfamily homologous superfamily	10 — Di-copper center containing domain from catechol oxidase

Domain ID domain_id	1wx5B01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1880 — protein ne1242 fold
Homologous superfamily homologous superfamily	10 — protein ne1242 domain like

Domain ID domain_id	1wx5C00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1280 — di-copper center containing domain from catechol oxidase
Homologous superfamily homologous superfamily	10 — Di-copper center containing domain from catechol oxidase

Domain ID domain_id	1wx5D01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1880 — protein ne1242 fold
Homologous superfamily homologous superfamily	10 — protein ne1242 domain like

▶

Unit-cell length a length_a	58.850 Å
Unit-cell length b length_b	93.200 Å
Unit-cell length c length_c	65.590 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	93.80 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.020 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2010
R_work r_work	0.2010
R_free r_free	0.2910

Crystal Structure of the copper-free Streptomyces castaneoglobisporus tyrosinase complexed with a caddie protein in the monoclinic crystal

1. Protein Identity and Related Structures Protein Identity & Related Structures

tyrosinase

State in the Current Structure

Other States of the Same Protein in the Database

MelC

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1wx5__assembly_2__model_1

1wx5__assembly_2__model_1 | I(q)

1wx5__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (6 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal Structure of the copper-free Streptomyces castaneoglobisporus tyrosinase complexed with a caddie protein in the monoclinic crystal

1. Protein Identity and Related Structures Protein Identity & Related Structures

tyrosinase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MelC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1wx5__assembly_2__model_1

1wx5__assembly_2__model_1 | I(q)

1wx5__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (6 domains)

CATH v4.4 (4 domains)

7. Citations (1)