SAXSdb — 1x0g

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

IscA

Thermosynechococcus elongatus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	SODIUM ION × 2 FE2/S2 (INORGANIC) CLUSTER × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8DLM0_SYNEL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–112； UniProt 1–112 Author chain B； PDBConstruct 1–112； UniProt 1–112 Author chain C； PDBConstruct 1–112； UniProt 1–112 Author chain D； PDBConstruct 1–112； UniProt 1–112

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1x0g
Deposition date deposition_date	2005-03-22
Structure title title	Crystal Structure of IscA with the [2Fe-2S] cluster
Keywords keywords	;[2Fe-2S], biosynthesis, cyanobacteria, domain swapping, Fe-S cluster, iron, iron-sulfur cluster protein, Isc, IscA, scaffold, sulfur, tetrameric, three conserved Cys, METAL BINDING PROTEIN ;; METAL BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1x0g__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1x0g__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1x0g__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.22 Å
Rg (electron density)	23.56 Å
Total Rg	24.30 Å
Atom count	3312
Residues	427
Excluded volume	58831 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1x0g__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	IscA
Molecular weight formula_weight	12368.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	3348

MVELTPAAIQELERLQTHGVRRGQAAILRIQVQPSECGDWRYDLALVAEPKPTDLLTQSQGWTIAIAAEAAELLRGLRVDYIEDLMGGAFRFHNPNASQTCGCGMAFRVSRS

Source Source

Source organism organism	Thermosynechococcus elongatus
NCBI taxonomy ID ncbi_taxonomy_id	197221
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	36

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1x0ga_
Class class	b — All beta proteins
Fold Fold fold	b.124 — HesB-like domain
Superfamily Superfamily superfamily	b.124.1 — HesB-like domain
Family Family family	b.124.1.0 — automated matches

Domain ID domain_id	d1x0gb_
Class class	b — All beta proteins
Fold Fold fold	b.124 — HesB-like domain
Superfamily Superfamily superfamily	b.124.1 — HesB-like domain
Family Family family	b.124.1.0 — automated matches

Domain ID domain_id	d1x0gc_
Class class	b — All beta proteins
Fold Fold fold	b.124 — HesB-like domain
Superfamily Superfamily superfamily	b.124.1 — HesB-like domain
Family Family family	b.124.1.0 — automated matches

Domain ID domain_id	d1x0gd_
Class class	b — All beta proteins
Fold Fold fold	b.124 — HesB-like domain
Superfamily Superfamily superfamily	b.124.1 — HesB-like domain
Family Family family	b.124.1.0 — automated matches

CATH v4.4 (4 domains)

Domain ID domain_id	1x0gA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	300 — Hypothetical Protein Aq_1857; Chain: A;
Homologous superfamily homologous superfamily	12 — HesB-like domain

Domain ID domain_id	1x0gB01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	300 — Hypothetical Protein Aq_1857; Chain: A;
Homologous superfamily homologous superfamily	12 — HesB-like domain

Domain ID domain_id	1x0gC00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	300 — Hypothetical Protein Aq_1857; Chain: A;
Homologous superfamily homologous superfamily	12 — HesB-like domain

Domain ID domain_id	1x0gD01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	300 — Hypothetical Protein Aq_1857; Chain: A;
Homologous superfamily homologous superfamily	12 — HesB-like domain

▶

Unit-cell length a length_a	77.472 Å
Unit-cell length b length_b	102.788 Å
Unit-cell length c length_c	137.032 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	I 2 2 2
Space-group number int_tables_number	23
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2030
R_work r_work	0.2011
R_free r_free	0.2415

Crystal Structure of IscA with the [2Fe-2S] cluster

1. Protein Identity and Related Structures Protein Identity & Related Structures

IscA

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1x0g__assembly_1__model_1

1x0g__assembly_1__model_1 | I(q)

1x0g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal Structure of IscA with the [2Fe-2S] cluster

1. Protein Identity and Related Structures Protein Identity & Related Structures

IscA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1x0g__assembly_1__model_1

1x0g__assembly_1__model_1 | I(q)

1x0g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)