1xf6

High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas CS24

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycoerythrin alpha-3 chain

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Phycoerythrin alpha-2 chain × 1 （P30943） B-phycoerythrin beta chain × 2 （P27198） MAGNESIUM ION × 2 15,16-DIHYDROBILIVERDIN × 2 CHLORIDE ION × 1 PHYCOERYTHROBILIN × 6 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHE3_RHOS2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–76； UniProt 53–128

Phycoerythrin alpha-2 chain

OrganismNot specified

UniProt P30943

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Phycoerythrin alpha-3 chain × 1 （Q00433） B-phycoerythrin beta chain × 2 （P27198） MAGNESIUM ION × 2 15,16-DIHYDROBILIVERDIN × 2 CHLORIDE ION × 1 PHYCOERYTHROBILIN × 6 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHE2_RHOS2
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–67； UniProt 38–104

B-phycoerythrin beta chain

OrganismNot specified

UniProt P27198

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Phycoerythrin alpha-3 chain × 1 （Q00433） Phycoerythrin alpha-2 chain × 1 （P30943） MAGNESIUM ION × 2 15,16-DIHYDROBILIVERDIN × 2 CHLORIDE ION × 1 PHYCOERYTHROBILIN × 6 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHEB_RHOS2
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–177； UniProt 1–177 Author chain D； PDBConstruct 1–177； UniProt 1–177

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1xf6
Deposition date deposition_date	2004-09-14
Structure title title	High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas CS24
Keywords keywords	phycoerythrin, light-harvesting protein, cryptophyte, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1xf6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1xf6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1xf6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.17 Å
Rg (electron density)	23.07 Å
Total Rg	23.85 Å
Atom count	3952
Residues	490
Excluded volume	70572 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1xf6__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Phycoerythrin alpha-3 chain
Molecular weight formula_weight	8135.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	5197

AMDKSAKAPQITIFDHRGCSRAPKESTGGKAGGQDDEMMVKVASTKVTVSESDAAKKLQEFITFEKGIDGPFTSKN

Entity 2 Entity 2 polymer

Description description	Phycoerythrin alpha-2 chain
Molecular weight formula_weight	7027.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

AMDKSAKAPVITIFDHRGCSRAPKEYTGAKAGGKDDEMMVKAQSVKIEVSTGTAEGVLATSLAKMTK

Entity 3 Entity 3 polymer

Description description	B-phycoerythrin beta chain
Molecular weight formula_weight	18539.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MLDAFSRVVTNADSKAAYVGGADLQALKKFISEGNKRLDSVNSIVSNASCIVSDAVSGMICENPSLISPSGNCYTNRRMAACLRDGEIILRYVSYALLSGDASVLEDRCLNGLKETYSSLGVPANSNARAVSIMKACAVAFVNNTASQKKLSTPQGDCSGLASEVGGYFDKVTAAIS

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	15,16-DIHYDROBILIVERDIN
Molecular weight formula_weight	584.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	PHYCOERYTHROBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1064

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1xf6a_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.184 — Non-globular alpha+beta subunits of globular proteins
Superfamily Superfamily superfamily	d.184.1 — Non-globular alpha+beta subunits of globular proteins
Family Family family	d.184.1.1 — Phycoerythrin 545 alpha-subunits

Domain ID domain_id	d1xf6b_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.184 — Non-globular alpha+beta subunits of globular proteins
Superfamily Superfamily superfamily	d.184.1 — Non-globular alpha+beta subunits of globular proteins
Family Family family	d.184.1.1 — Phycoerythrin 545 alpha-subunits

Domain ID domain_id	d1xf6c_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.3 — Phycocyanin-like phycobilisome proteins

Domain ID domain_id	d1xf6d_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.3 — Phycocyanin-like phycobilisome proteins

CATH v4.4 (4 domains)

Domain ID domain_id	1xf6A00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	510 — Cryptophytan Phycoerythrin (Alpha-1 Chain); Chain A
Homologous superfamily homologous superfamily	10 — Phycoerythrin alpha chain

Domain ID domain_id	1xf6B00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	510 — Cryptophytan Phycoerythrin (Alpha-1 Chain); Chain A
Homologous superfamily homologous superfamily	10 — Phycoerythrin alpha chain

Domain ID domain_id	1xf6C00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	20 — Phycocyanins

Domain ID domain_id	1xf6D00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	20 — Phycocyanins

▶

Unit-cell length a length_a	62.980 Å
Unit-cell length b length_b	82.555 Å
Unit-cell length c length_c	89.530 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.100 Å
Low-resolution limit resolution_low	60.860 Å
R factor r_factor	0.0966
R_work r_work	0.0961
R_free r_free	0.1157

High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas CS24

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycoerythrin alpha-3 chain

State in the Current Structure

Other States of the Same Protein in the Database

Phycoerythrin alpha-2 chain

State in the Current Structure

Other States of the Same Protein in the Database

B-phycoerythrin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1xf6__assembly_1__model_1

1xf6__assembly_1__model_1 | I(q)

1xf6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (3)

High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas CS24

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycoerythrin alpha-3 chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycoerythrin alpha-2 chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

B-phycoerythrin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1xf6__assembly_1__model_1

1xf6__assembly_1__model_1 | I(q)

1xf6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (3)