SAXSdb — 1xmz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

GFP-like non-fluorescent chromoprotein FP595 chain 1

Anemonia sulcata

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 8	BETA-MERCAPTOETHANOL × 14 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NFCP_ANESU
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 13–73； UniProt 2–62 Author chain B； PDBConstruct 13–73； UniProt 2–62 Author chain C； PDBConstruct 1–168； UniProt 63–232 Author chain D； PDBConstruct 1–168； UniProt 63–232

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1xmz
Deposition date deposition_date	2004-10-04
Structure title title	Crystal structure of the dark state of kindling fluorescent protein kfp from anemonia sulcata
Keywords keywords	FLUORESCENT PROTEIN, CHROMOPHORE STRUCTURE, ASCP595, LUMINESCENT PROTEIN; LUMINESCENT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1xmz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1xmz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1xmz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.56 Å
Rg (electron density)	27.75 Å
Total Rg	28.73 Å
Atom count	7290
Residues	910
Excluded volume	129570 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1xmz__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	GFP-like non-fluorescent chromoprotein FP595 chain 1
Molecular weight formula_weight	8065.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4295

MRGSHHHHHHGSASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSCX

Source Source

Source organism organism	Anemonia sulcata
Common name common_name	snake-locks sea anemone
NCBI taxonomy ID ncbi_taxonomy_id	6108
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	GFP-like non-fluorescent chromoprotein FP595 chain 2
Molecular weight formula_weight	19143.7 kDa
Mutation mutation	A143G
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

XSKTFIKYVSGIPDYFKQSFPEGFTWERTTTYEDGGFLTAHQDTSLDGDCLVYKVKILGNNFPADGPVMQNKAGRWEPGTEIVYEVDGVLRGQSLMALKCPGGRHLTCHLHTTYRSKKPASALKMPGFHFEDHRIEIMEEVEKGKCYKQYEAAVGRYCDAAPSKLGHN

Source Source

Source organism organism	Anemonia sulcata
Common name common_name	snake-locks sea anemone
NCBI taxonomy ID ncbi_taxonomy_id	6108
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	BETA-MERCAPTOETHANOL
Molecular weight formula_weight	78.1 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	463

▼

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1xmza_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.22 — GFP-like
Superfamily Superfamily superfamily	d.22.1 — GFP-like
Family Family family	d.22.1.1 — Fluorescent proteins

Domain ID domain_id	d1xmzb1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.22 — GFP-like
Superfamily Superfamily superfamily	d.22.1 — GFP-like
Family Family family	d.22.1.1 — Fluorescent proteins

Domain ID domain_id	d1xmzb2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

▶

7. Citations (7)

Kindling Fluorescent Protein from Anemonia sulcata: Dark-State Structure at 1.38 Resolution

Biochemistry (2005)

PMID: 15823036 · DOI: 10.1021/bi047644u PRIMARY

Kindling Fluorescent Proteins for Precise in Vivo Photolabeling

NAT.BIOTECHNOL. (2003)

Interconversion of Anthozoa Gfp-Like Fluorescent and Nonfluorescent Proteins by Mutagenesis

BMC BIOCHEM. (2002)

;Chromophore Environment Provides Clue to "Kindling Fluorescent Protein" Riddle ;

J.Biol.Chem. (2002)

;Alternative Cyclization in Gfp-Like Proteins Family. The Formation and Structure of the Chromophore of a Purple Chromoprotein from Anemonia Sulcata ;

J.Biol.Chem. (2001)

Natural Animal Coloration Can be Determined by a Nonfluorescent Green Fluorescent Protein Homolog

J.Biol.Chem. (2000)

Synthesis and Properties of the Chromophore of Asulcp Chromoprotein from Anemonia Sulcata

To be Published

Unit-cell length a length_a	76.520 Å
Unit-cell length b length_b	125.400 Å
Unit-cell length c length_c	92.750 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	1.380 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.1404
R_work r_work	0.1393
R_free r_free	0.1913

Crystal structure of the dark state of kindling fluorescent protein kfp from anemonia sulcata

1. Protein Identity and Related Structures Protein Identity & Related Structures

GFP-like non-fluorescent chromoprotein FP595 chain 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1xmz__assembly_1__model_1

1xmz__assembly_1__model_1 | I(q)

1xmz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (3 domains)

7. Citations (7)

Crystal structure of the dark state of kindling fluorescent protein kfp from anemonia sulcata

1. Protein Identity and Related Structures Protein Identity & Related Structures

GFP-like non-fluorescent chromoprotein FP595 chain 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1xmz__assembly_1__model_1

1xmz__assembly_1__model_1 | I(q)

1xmz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (3 domains)

7. Citations (7)