SAXSdb — 1xty

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Peptidyl-tRNA hydrolase

Sulfolobus solfataricus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 4 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 4 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PTH_SULSO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–120； UniProt 1–120 Author chain B； PDBConstruct 1–120； UniProt 1–120 Author chain C； PDBConstruct 1–120； UniProt 1–120 Author chain D； PDBConstruct 1–120； UniProt 1–120

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1xty
Deposition date deposition_date	2004-10-25
Structure title title	Crystal structure of Sulfolobus solfataricus peptidyl-tRNA hydrolase
Keywords keywords	mixed beta sheet, hydrolase; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1xty__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1xty__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1xty__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.77 Å
Rg (electron density)	17.44 Å
Total Rg	18.45 Å
Atom count	1860
Residues	240
Excluded volume	33774 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1xty__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1xty__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Peptidyl-tRNA hydrolase
Molecular weight formula_weight	13155.5 kDa
EC 编号 ec_number	3.1.1.29
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	4218

MIKMVIVVRSDIKMGKGKIAAQVAHAAVTLVVSIINSNNLRWKEWLNEWLHQGQPKIIVKVNSLDEIISRAKKAETMNLPFSIIEDAGKTQLEPGTITCLGIGPAPENLVDSITGDLKLL

Source Source

Source organism organism	Sulfolobus solfataricus
NCBI taxonomy ID ncbi_taxonomy_id	273057
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	498

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1xtya_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.131 — Peptidyl-tRNA hydrolase II
Superfamily Superfamily superfamily	c.131.1 — Peptidyl-tRNA hydrolase II
Family Family family	c.131.1.0 — automated matches

Domain ID domain_id	d1xtyb_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.131 — Peptidyl-tRNA hydrolase II
Superfamily Superfamily superfamily	c.131.1 — Peptidyl-tRNA hydrolase II
Family Family family	c.131.1.0 — automated matches

Domain ID domain_id	d1xtyc_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.131 — Peptidyl-tRNA hydrolase II
Superfamily Superfamily superfamily	c.131.1 — Peptidyl-tRNA hydrolase II
Family Family family	c.131.1.0 — automated matches

Domain ID domain_id	d1xtyd_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.131 — Peptidyl-tRNA hydrolase II
Superfamily Superfamily superfamily	c.131.1 — Peptidyl-tRNA hydrolase II
Family Family family	c.131.1.0 — automated matches

CATH v4.4 (4 domains)

Domain ID domain_id	1xtyA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1490 — Bit1
Homologous superfamily homologous superfamily	10 — Bit1

Domain ID domain_id	1xtyB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1490 — Bit1
Homologous superfamily homologous superfamily	10 — Bit1

Domain ID domain_id	1xtyC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1490 — Bit1
Homologous superfamily homologous superfamily	10 — Bit1

Domain ID domain_id	1xtyD00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1490 — Bit1
Homologous superfamily homologous superfamily	10 — Bit1

▶

Unit-cell length a length_a	46.816 Å
Unit-cell length b length_b	67.232 Å
Unit-cell length c length_c	85.352 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	95.08 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	46.600 Å
R factor r_factor	0.2050
R_work r_work	0.2050
R_free r_free	0.2240

Crystal structure of Sulfolobus solfataricus peptidyl-tRNA hydrolase

1. Protein Identity and Related Structures Protein Identity & Related Structures

Peptidyl-tRNA hydrolase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1xty__assembly_2__model_1

1xty__assembly_2__model_1 | I(q)

1xty__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of Sulfolobus solfataricus peptidyl-tRNA hydrolase

1. Protein Identity and Related Structures Protein Identity & Related Structures

Peptidyl-tRNA hydrolase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1xty__assembly_2__model_1

1xty__assembly_2__model_1 | I(q)

1xty__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)