SAXSdb — 1y74

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

lin 7 homolog b

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Peripheral plasma membrane protein CASK × 2 （O70589）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LIN7B_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–57； UniProt 8–64 Author chain C； PDBConstruct 1–57； UniProt 8–64

Peripheral plasma membrane protein CASK

Mus musculus

UniProt O70589

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	lin 7 homolog b × 2 （O88951）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSKP_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–50； UniProt 405–454 Author chain D； PDBConstruct 1–50； UniProt 405–454

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1y74
Deposition date deposition_date	2004-12-08
Structure title title	Solution Structure of mLin-2/mLin-7 L27 Domain Complex
Keywords keywords	L27 domain, scaffold protein, protein assembly, cell polarity, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	SOLUTION NMR

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1y74__assembly_1__model_20

Assembly 1 · Model 20 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1y74__assembly_1__model_20 | I(q)

100 plotted points; both axes use logarithmic scales.

1y74__assembly_1__model_20 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.58 Å
Rg (electron density)	20.59 Å
Total Rg	21.39 Å
Atom count	3500
Residues	214
Excluded volume	30944 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1y74__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	2	`1y74__assembly_1__model_2`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	3	`1y74__assembly_1__model_3`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	4	`1y74__assembly_1__model_4`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	5	`1y74__assembly_1__model_5`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	6	`1y74__assembly_1__model_6`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	7	`1y74__assembly_1__model_7`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	8	`1y74__assembly_1__model_8`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	9	`1y74__assembly_1__model_9`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	10	`1y74__assembly_1__model_10`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	11	`1y74__assembly_1__model_11`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	12	`1y74__assembly_1__model_12`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	13	`1y74__assembly_1__model_13`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	14	`1y74__assembly_1__model_14`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	15	`1y74__assembly_1__model_15`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	16	`1y74__assembly_1__model_16`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	17	`1y74__assembly_1__model_17`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	18	`1y74__assembly_1__model_18`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	19	`1y74__assembly_1__model_19`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	20	`1y74__assembly_1__model_20`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	lin 7 homolog b
Molecular weight formula_weight	6652.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	70000

LGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDIT

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Peripheral plasma membrane protein CASK
Molecular weight formula_weight	5788.5 kDa
EC 编号 ec_number	2.7.1.-
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

AVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSD

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1y74a1
Class class	a — All alpha proteins
Fold Fold fold	a.194 — L27 domain
Superfamily Superfamily superfamily	a.194.1 — L27 domain
Family Family family	a.194.1.1 — L27 domain

Domain ID domain_id	d1y74b_
Class class	a — All alpha proteins
Fold Fold fold	a.194 — L27 domain
Superfamily Superfamily superfamily	a.194.1 — L27 domain
Family Family family	a.194.1.1 — L27 domain

Domain ID domain_id	d1y74c_
Class class	a — All alpha proteins
Fold Fold fold	a.194 — L27 domain
Superfamily Superfamily superfamily	a.194.1 — L27 domain
Family Family family	a.194.1.1 — L27 domain

Domain ID domain_id	d1y74d_
Class class	a — All alpha proteins
Fold Fold fold	a.194 — L27 domain
Superfamily Superfamily superfamily	a.194.1 — L27 domain
Family Family family	a.194.1.1 — L27 domain

CATH v4.4 (4 domains)

Domain ID domain_id	1y74A00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	650 — L27 domain

Domain ID domain_id	1y74B00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	650 — L27 domain

Domain ID domain_id	1y74C00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	650 — L27 domain

Domain ID domain_id	1y74D00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	650 — L27 domain

▶

Solution Structure of mLin-2/mLin-7 L27 Domain Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

lin 7 homolog b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Peripheral plasma membrane protein CASK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1y74__assembly_1__model_20

1y74__assembly_1__model_20 | I(q)

1y74__assembly_1__model_20 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)