1yrq

Structure of the ready oxidized form of [NiFe]-hydrogenase

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Periplasmic [NiFe] hydrogenase small subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Periplasmic [NiFe] hydrogenase large subunit × 1 （P18188） IRON/SULFUR CLUSTER × 2 FE3-S4 CLUSTER × 1 NICKEL (II) ION × 1 MAGNESIUM ION × 1 CARBONMONOXIDE-(DICYANO) IRON × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Periplasmic [NiFe] hydrogenase large subunit × 1 （P18188） IRON/SULFUR CLUSTER × 2 FE3-S4 CLUSTER × 1 NICKEL (II) ION × 1 MAGNESIUM ION × 1 CARBONMONOXIDE-(DICYANO) IRON × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Periplasmic [NiFe] hydrogenase large subunit × 1 （P18188） IRON/SULFUR CLUSTER × 2 FE3-S4 CLUSTER × 1 NICKEL (II) ION × 1 MAGNESIUM ION × 1 CARBONMONOXIDE-(DICYANO) IRON × 1 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Periplasmic [NiFe] hydrogenase large subunit × 1 （P18188） IRON/SULFUR CLUSTER × 2 FE3-S4 CLUSTER × 1 NICKEL (II) ION × 1 MAGNESIUM ION × 1 CARBONMONOXIDE-(DICYANO) IRON × 1 water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Periplasmic [NiFe] hydrogenase large subunit × 1 （P18188） IRON/SULFUR CLUSTER × 2 FE3-S4 CLUSTER × 1 NICKEL (II) ION × 1 MAGNESIUM ION × 1 CARBONMONOXIDE-(DICYANO) IRON × 1 water × 2	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Periplasmic [NiFe] hydrogenase large subunit × 1 （P18188） IRON/SULFUR CLUSTER × 2 FE3-S4 CLUSTER × 1 NICKEL (II) ION × 1 MAGNESIUM ION × 1 CARBONMONOXIDE-(DICYANO) IRON × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHNS_DESFR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–264； UniProt 51–314 Author chain B； PDBConstruct 1–264； UniProt 51–314 Author chain C； PDBConstruct 1–264； UniProt 51–314 Author chain D； PDBConstruct 1–264； UniProt 51–314 Author chain F； PDBConstruct 1–264； UniProt 51–314 Author chain G； PDBConstruct 1–264； UniProt 51–314

Periplasmic [NiFe] hydrogenase large subunit

OrganismNot specified

UniProt P18188

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Periplasmic [NiFe] hydrogenase small subunit × 1 （P18187） IRON/SULFUR CLUSTER × 2 FE3-S4 CLUSTER × 1 NICKEL (II) ION × 1 MAGNESIUM ION × 1 CARBONMONOXIDE-(DICYANO) IRON × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Periplasmic [NiFe] hydrogenase small subunit × 1 （P18187） IRON/SULFUR CLUSTER × 2 FE3-S4 CLUSTER × 1 NICKEL (II) ION × 1 MAGNESIUM ION × 1 CARBONMONOXIDE-(DICYANO) IRON × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Periplasmic [NiFe] hydrogenase small subunit × 1 （P18187） IRON/SULFUR CLUSTER × 2 FE3-S4 CLUSTER × 1 NICKEL (II) ION × 1 MAGNESIUM ION × 1 CARBONMONOXIDE-(DICYANO) IRON × 1 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Periplasmic [NiFe] hydrogenase small subunit × 1 （P18187） IRON/SULFUR CLUSTER × 2 FE3-S4 CLUSTER × 1 NICKEL (II) ION × 1 MAGNESIUM ION × 1 CARBONMONOXIDE-(DICYANO) IRON × 1 water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Periplasmic [NiFe] hydrogenase small subunit × 1 （P18187） IRON/SULFUR CLUSTER × 2 FE3-S4 CLUSTER × 1 NICKEL (II) ION × 1 MAGNESIUM ION × 1 CARBONMONOXIDE-(DICYANO) IRON × 1 water × 2	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Periplasmic [NiFe] hydrogenase small subunit × 1 （P18187） IRON/SULFUR CLUSTER × 2 FE3-S4 CLUSTER × 1 NICKEL (II) ION × 1 MAGNESIUM ION × 1 CARBONMONOXIDE-(DICYANO) IRON × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHNL_DESFR
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–549； UniProt 1–549 Author chain I； PDBConstruct 1–549； UniProt 1–549 Author chain J； PDBConstruct 1–549； UniProt 1–549 Author chain K； PDBConstruct 1–549； UniProt 1–549 Author chain M； PDBConstruct 1–549； UniProt 1–549 Author chain N； PDBConstruct 1–549； UniProt 1–549

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1yrq
Deposition date deposition_date	2005-02-04
Structure title title	Structure of the ready oxidized form of [NiFe]-hydrogenase
Keywords keywords	NiB state, hydroxide bridge, Oxidoreductase; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1yrq__assembly_4__model_2

Assembly 4 · Model 2 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1yrq__assembly_4__model_2 | I(q)

100 plotted points; both axes use logarithmic scales.

1yrq__assembly_4__model_2 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.51 Å
Rg (electron density)	24.61 Å
Total Rg	25.44 Å
Atom count	6165
Residues	806
Excluded volume	110090 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1yrq__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	2	`1yrq__assembly_1__model_2`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1yrq__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	2	`1yrq__assembly_2__model_2`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1yrq__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	2	`1yrq__assembly_3__model_2`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1yrq__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	2	`1yrq__assembly_4__model_2`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`1yrq__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	2	`1yrq__assembly_5__model_2`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`1yrq__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	2	`1yrq__assembly_6__model_2`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Periplasmic [NiFe] hydrogenase small subunit
Molecular weight formula_weight	28305.3 kDa
EC 编号 ec_number	1.12.2.1
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,F,G
Atom count atom_count	77694

LTAKHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDSNGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG

Entity 2 Entity 2 polymer

Description description	Periplasmic [NiFe] hydrogenase large subunit
Molecular weight formula_weight	59729.3 kDa
EC 编号 ec_number	1.12.2.1
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,I,J,K,M,N

MAESKPTPQSTFTGPIVVDPITRIEGHLRIMVEVENGKVKDAWSSSQLFRGLEIILKGRDPRDAQHFTQRACGVCTYVHALASSRCVDDAVKVSIPANARMMRNLVMASQYLHDHLVHFYHLHALDWVDVTAALKADPNKAAKLAASIAPARPGNSAKALKAVQDKLKAFVESGQLGIFTNAYFLGGHKAYYLPPEVNLIATAHYLEALHMQVKAASAMAILGGKNPHTQFTVVGGCSNYQGLTKDPLANYLALSKEVCQFVNECYIPDLLAVAGFYKDWGGIGGTSNYLAFGEFATDDSSPSKHLATSQFPSGVITGRDLGKVDNVDLGAIYEDVKYSWYAPGGDGKHPYDGVTDPKYTKLDDKDHYSWMKAPRYKGKAMEVGPLARTFIAYAKGQPDFKKVVDMVLGKLSVPATALHSTLGRTAARGIETAIVCANMEKWIKEMADSGAKDNTLCAKWEMPEESKGVGLADAPRGALSHWIRIKGKKIDNFQLVVPSTWNLGPRGAQGDKSPVEEALIGTPIADPKRPVEILRTVHAFDPCIACGVH

Entity 3 Entity 3 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 4 Entity 4 non-polymer

Description description	FE3-S4 CLUSTER
Molecular weight formula_weight	295.8 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 5 Entity 5 non-polymer

Description description	NICKEL (II) ION
Molecular weight formula_weight	58.7 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 6 Entity 6 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 7 Entity 7 non-polymer

Description description	CARBONMONOXIDE-(DICYANO) IRON
Molecular weight formula_weight	135.9 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1886

▼

6. Fold Classification (SCOP + CATH) 30 domains

SCOP 2.08 (12 domains)

Domain ID domain_id	d1yrqa_
Class class	e — Multi-domain proteins (alpha and beta)
Fold Fold fold	e.19 — HydA/Nqo6-like
Superfamily Superfamily superfamily	e.19.1 — HydA/Nqo6-like
Family Family family	e.19.1.1 — Nickel-iron hydrogenase, small subunit

Domain ID domain_id	d1yrqb_
Class class	e — Multi-domain proteins (alpha and beta)
Fold Fold fold	e.19 — HydA/Nqo6-like
Superfamily Superfamily superfamily	e.19.1 — HydA/Nqo6-like
Family Family family	e.19.1.1 — Nickel-iron hydrogenase, small subunit

Domain ID domain_id	d1yrqc_
Class class	e — Multi-domain proteins (alpha and beta)
Fold Fold fold	e.19 — HydA/Nqo6-like
Superfamily Superfamily superfamily	e.19.1 — HydA/Nqo6-like
Family Family family	e.19.1.1 — Nickel-iron hydrogenase, small subunit

Domain ID domain_id	d1yrqd_
Class class	e — Multi-domain proteins (alpha and beta)
Fold Fold fold	e.19 — HydA/Nqo6-like
Superfamily Superfamily superfamily	e.19.1 — HydA/Nqo6-like
Family Family family	e.19.1.1 — Nickel-iron hydrogenase, small subunit

Domain ID domain_id	d1yrqf_
Class class	e — Multi-domain proteins (alpha and beta)
Fold Fold fold	e.19 — HydA/Nqo6-like
Superfamily Superfamily superfamily	e.19.1 — HydA/Nqo6-like
Family Family family	e.19.1.1 — Nickel-iron hydrogenase, small subunit

Domain ID domain_id	d1yrqg_
Class class	e — Multi-domain proteins (alpha and beta)
Fold Fold fold	e.19 — HydA/Nqo6-like
Superfamily Superfamily superfamily	e.19.1 — HydA/Nqo6-like
Family Family family	e.19.1.1 — Nickel-iron hydrogenase, small subunit

Domain ID domain_id	d1yrqh_
Class class	e — Multi-domain proteins (alpha and beta)
Fold Fold fold	e.18 — HydB/Nqo4-like
Superfamily Superfamily superfamily	e.18.1 — HydB/Nqo4-like
Family Family family	e.18.1.1 — Nickel-iron hydrogenase, large subunit

Domain ID domain_id	d1yrqi_
Class class	e — Multi-domain proteins (alpha and beta)
Fold Fold fold	e.18 — HydB/Nqo4-like
Superfamily Superfamily superfamily	e.18.1 — HydB/Nqo4-like
Family Family family	e.18.1.1 — Nickel-iron hydrogenase, large subunit

Domain ID domain_id	d1yrqj_
Class class	e — Multi-domain proteins (alpha and beta)
Fold Fold fold	e.18 — HydB/Nqo4-like
Superfamily Superfamily superfamily	e.18.1 — HydB/Nqo4-like
Family Family family	e.18.1.1 — Nickel-iron hydrogenase, large subunit

Domain ID domain_id	d1yrqk_
Class class	e — Multi-domain proteins (alpha and beta)
Fold Fold fold	e.18 — HydB/Nqo4-like
Superfamily Superfamily superfamily	e.18.1 — HydB/Nqo4-like
Family Family family	e.18.1.1 — Nickel-iron hydrogenase, large subunit

Domain ID domain_id	d1yrqm_
Class class	e — Multi-domain proteins (alpha and beta)
Fold Fold fold	e.18 — HydB/Nqo4-like
Superfamily Superfamily superfamily	e.18.1 — HydB/Nqo4-like
Family Family family	e.18.1.1 — Nickel-iron hydrogenase, large subunit

Domain ID domain_id	d1yrqn_
Class class	e — Multi-domain proteins (alpha and beta)
Fold Fold fold	e.18 — HydB/Nqo4-like
Superfamily Superfamily superfamily	e.18.1 — HydB/Nqo4-like
Family Family family	e.18.1.1 — Nickel-iron hydrogenase, large subunit

CATH v4.4 (18 domains)

Domain ID domain_id	1yrqA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	700 — NADH:ubiquinone oxidoreductase-like, 20kDa subunit

Domain ID domain_id	1yrqA02
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	480 — Cytochrome-c3 Hydrogenase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 hydrogenase, C-terminal domain

Domain ID domain_id	1yrqB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	700 — NADH:ubiquinone oxidoreductase-like, 20kDa subunit

Domain ID domain_id	1yrqB02
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	480 — Cytochrome-c3 Hydrogenase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 hydrogenase, C-terminal domain

Domain ID domain_id	1yrqC01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	700 — NADH:ubiquinone oxidoreductase-like, 20kDa subunit

Domain ID domain_id	1yrqC02
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	480 — Cytochrome-c3 Hydrogenase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 hydrogenase, C-terminal domain

Domain ID domain_id	1yrqD01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	700 — NADH:ubiquinone oxidoreductase-like, 20kDa subunit

Domain ID domain_id	1yrqD02
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	480 — Cytochrome-c3 Hydrogenase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 hydrogenase, C-terminal domain

Domain ID domain_id	1yrqF01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	700 — NADH:ubiquinone oxidoreductase-like, 20kDa subunit

Domain ID domain_id	1yrqF02
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	480 — Cytochrome-c3 Hydrogenase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 hydrogenase, C-terminal domain

Domain ID domain_id	1yrqG01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	700 — NADH:ubiquinone oxidoreductase-like, 20kDa subunit

Domain ID domain_id	1yrqG02
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	480 — Cytochrome-c3 Hydrogenase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 hydrogenase, C-terminal domain

Domain ID domain_id	1yrqH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	645 — Cytochrome-c3 Hydrogenase; chain B
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 Hydrogenase, chain B

Domain ID domain_id	1yrqI00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	645 — Cytochrome-c3 Hydrogenase; chain B
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 Hydrogenase, chain B

Domain ID domain_id	1yrqJ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	645 — Cytochrome-c3 Hydrogenase; chain B
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 Hydrogenase, chain B

Domain ID domain_id	1yrqK00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	645 — Cytochrome-c3 Hydrogenase; chain B
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 Hydrogenase, chain B

Domain ID domain_id	1yrqM00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	645 — Cytochrome-c3 Hydrogenase; chain B
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 Hydrogenase, chain B

Domain ID domain_id	1yrqN00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	645 — Cytochrome-c3 Hydrogenase; chain B
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 Hydrogenase, chain B

▶

Unit-cell length a length_a	127.500 Å
Unit-cell length b length_b	99.700 Å
Unit-cell length c length_c	183.200 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	91.80 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.1730
R_work r_work	0.1710
R_free r_free	0.2200

Structure of the ready oxidized form of [NiFe]-hydrogenase

1. Protein Identity and Related Structures Protein Identity & Related Structures

Periplasmic [NiFe] hydrogenase small subunit

State in the Current Structure

Other States of the Same Protein in the Database

Periplasmic [NiFe] hydrogenase large subunit

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1yrq__assembly_4__model_2

1yrq__assembly_4__model_2 | I(q)

1yrq__assembly_4__model_2 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

6. Fold Classification (SCOP + CATH) 30 domains

SCOP 2.08 (12 domains)

CATH v4.4 (18 domains)

7. Citations (3)

Structure of the ready oxidized form of [NiFe]-hydrogenase

1. Protein Identity and Related Structures Protein Identity & Related Structures

Periplasmic [NiFe] hydrogenase small subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Periplasmic [NiFe] hydrogenase large subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1yrq__assembly_4__model_2

1yrq__assembly_4__model_2 | I(q)

1yrq__assembly_4__model_2 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

6. Fold Classification (SCOP + CATH) 30 domains

SCOP 2.08 (12 domains)

CATH v4.4 (18 domains)

7. Citations (3)