SAXSdb — 22iy

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Astaxanthin-binding pink protein of fasciclin family

Scenedesmus sp. Oki-4N

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	GLYCEROL × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7G1GF05_9CHLO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 26–192； UniProt 25–191

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	22iy
Deposition date deposition_date	2026-01-13
Structure title title	Crystal structure of the unliganded microalgal AstaP-pink1 carotenoprotein
Keywords keywords	Microalgal protein, carotenoprotein, AstaP-pink1, unliganded form, astaxanthin-binding pink protein, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

22iy__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

22iy__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

22iy__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.51 Å
Rg (electron density)	14.87 Å
Total Rg	16.05 Å
Atom count	1175
Residues	161
Excluded volume	20883 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`22iy__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Astaxanthin-binding pink protein of fasciclin family
Molecular weight formula_weight	20186.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1322

MGSSHHHHHHSSGLEVLFQGPHIHMAPAPAKRGLTAALQQAAASAPQLSTLVAAIQASGLQIPDDAAWTIFAPTNEAFADDDVREKTGLTAQQLLKPANKDALVKLLSYHVVPAGAVRSTKLTDGQVLQTLLKGATLKVDLDEDDGRRKIEIESSAGDDDGADVVRADIVAGNSIIHVVDDVLIPAALRKSG

Source Source

Source organism organism	Scenedesmus sp. Oki-4N
NCBI taxonomy ID ncbi_taxonomy_id	2650458
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	119

▶

Unit-cell length a length_a	40.483 Å
Unit-cell length b length_b	56.525 Å
Unit-cell length c length_c	58.692 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.650 Å
Low-resolution limit resolution_low	40.710 Å
R factor r_factor	0.1783
R_work r_work	0.1757
R_free r_free	0.2281

Crystal structure of the unliganded microalgal AstaP-pink1 carotenoprotein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Astaxanthin-binding pink protein of fasciclin family

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

22iy__assembly_1__model_1

22iy__assembly_1__model_1 | I(q)

22iy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)

Crystal structure of the unliganded microalgal AstaP-pink1 carotenoprotein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Astaxanthin-binding pink protein of fasciclin family

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

22iy__assembly_1__model_1

22iy__assembly_1__model_1 | I(q)

22iy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)