SAXSdb — 23fi

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP phosphoribosyltransferase

Acinetobacter baumannii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	FORMIC ACID × 6 ACETATE ION × 2 MAGNESIUM ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0ABF7PKC5_ACIBA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–227； UniProt 1–227 Author chain B； PDBConstruct 1–227； UniProt 1–227

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	23fi
Deposition date deposition_date	2026-02-04
Last revision last_revision	2026-02-18
Structure title title	Crystal structure of short-form adenosine triphosphate phosphoribosyltransferase from Acinetobacter baumannii at 1.94 angstrom resolution
Keywords keywords	HisG, ATPPRT, PRT, TRANSFERASE, Histidine biosynthesis; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

23fi__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

23fi__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

23fi__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.95 Å
Rg (electron density)	23.71 Å
Total Rg	24.54 Å
Atom count	3514
Residues	450
Excluded volume	63346 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`23fi__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	ATP phosphoribosyltransferase
Molecular weight formula_weight	25113.2 kDa
EC 编号 ec_number	2.4.2.17
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3855

MNDVRNDDPNFNVMGNFDHGLTLALSKGRILKETLPLLATAGINLLEDPEKSRKLIFPTTHKQVRILILRASDVPTYVENGAADLGVAGKDVLMEHGAQHVYELLDLQIAKCKLMTAGKVGMERPKGRLKIATKYVNLTRQYYASLGEQVDVIKLYGSMELAPLVGLGDYIVDVVDTGNTLRANGLEPLEEICKVSSRLIVNKASFKRKQVLLNPIISQLEQAVQSR

Source Source

Source organism organism	Acinetobacter baumannii
NCBI taxonomy ID ncbi_taxonomy_id	470
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	FORMIC ACID
Molecular weight formula_weight	46.0 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 3 Entity 3 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	303

▶

Unit-cell length a length_a	74.717 Å
Unit-cell length b length_b	75.234 Å
Unit-cell length c length_c	96.885 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.942 Å
Low-resolution limit resolution_low	46.510 Å
R factor r_factor	—
R_work r_work	0.1862
R_free r_free	0.2368

Crystal structure of short-form adenosine triphosphate phosphoribosyltransferase from Acinetobacter baumannii at 1.94 angstrom resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP phosphoribosyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

23fi__assembly_1__model_1

23fi__assembly_1__model_1 | I(q)

23fi__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Crystal structure of short-form adenosine triphosphate phosphoribosyltransferase from Acinetobacter baumannii at 1.94 angstrom resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP phosphoribosyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

23fi__assembly_1__model_1

23fi__assembly_1__model_1 | I(q)

23fi__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)