SAXSdb — 2a5w

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

sulfite reductase, desulfoviridin-type subunit gamma (dsvC)

Archaeoglobus fulgidus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	SULFATE ION × 2 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	SULFATE ION × 2 water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O28055_ARCFU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–115； UniProt 1–115 Author chain B； PDBConstruct 1–115； UniProt 1–115 Author chain C； PDBConstruct 1–115； UniProt 1–115

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2a5w
Deposition date deposition_date	2005-07-01
Structure title title	Crystal structure of the oxidized gamma-subunit of the dissimilatory sulfite reductase (DsrC) from Archaeoglobus fulgidus
Keywords keywords	orthogonal helix bundle, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2a5w__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2a5w__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2a5w__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.11 Å
Rg (electron density)	13.78 Å
Total Rg	15.16 Å
Atom count	941
Residues	114
Excluded volume	16900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2a5w__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2a5w__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2a5w__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2a5w__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	sulfite reductase, desulfoviridin-type subunit gamma (dsvC)
Molecular weight formula_weight	13498.7 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	3033

MPELEVKGKKLRLDEDGFLQDWEEWDEEVAEALAKDTRFSPQPIELTEEHWKIIRYLRDYFIKYGVAPPVRMLVKHCKKEVRPDCNLQYIYKLFPQGPAKDACRIAGLPKPTGCV

Source Source

Source organism organism	Archaeoglobus fulgidus
NCBI taxonomy ID ncbi_taxonomy_id	224325
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	186

▼

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d2a5wa_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.203 — DsrC, the gamma subunit of dissimilatory sulfite reductase
Superfamily Superfamily superfamily	d.203.1 — DsrC, the gamma subunit of dissimilatory sulfite reductase
Family Family family	d.203.1.1 — DsrC, the gamma subunit of dissimilatory sulfite reductase

Domain ID domain_id	d2a5wb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.203 — DsrC, the gamma subunit of dissimilatory sulfite reductase
Superfamily Superfamily superfamily	d.203.1 — DsrC, the gamma subunit of dissimilatory sulfite reductase
Family Family family	d.203.1.1 — DsrC, the gamma subunit of dissimilatory sulfite reductase

Domain ID domain_id	d2a5wc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.203 — DsrC, the gamma subunit of dissimilatory sulfite reductase
Superfamily Superfamily superfamily	d.203.1 — DsrC, the gamma subunit of dissimilatory sulfite reductase
Family Family family	d.203.1.1 — DsrC, the gamma subunit of dissimilatory sulfite reductase

CATH v4.4 (6 domains)

Domain ID domain_id	2a5wA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1420 — Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1
Homologous superfamily homologous superfamily	10 — DsrC protein, N-terminal domain

Domain ID domain_id	2a5wA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	370 — DsrC protein, C-terminal domain

Domain ID domain_id	2a5wB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1420 — Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1
Homologous superfamily homologous superfamily	10 — DsrC protein, N-terminal domain

Domain ID domain_id	2a5wB02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	370 — DsrC protein, C-terminal domain

Domain ID domain_id	2a5wC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1420 — Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1
Homologous superfamily homologous superfamily	10 — DsrC protein, N-terminal domain

Domain ID domain_id	2a5wC02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	370 — DsrC protein, C-terminal domain

▶

Unit-cell length a length_a	49.220 Å
Unit-cell length b length_b	64.800 Å
Unit-cell length c length_c	129.712 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	28.990 Å
R factor r_factor	0.2036
R_work r_work	0.2022
R_free r_free	0.2306

Crystal structure of the oxidized gamma-subunit of the dissimilatory sulfite reductase (DsrC) from Archaeoglobus fulgidus

1. Protein Identity and Related Structures Protein Identity & Related Structures

sulfite reductase, desulfoviridin-type subunit gamma (dsvC)

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2a5w__assembly_3__model_1

2a5w__assembly_3__model_1 | I(q)

2a5w__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (3 domains)

CATH v4.4 (6 domains)

7. Citations (1)

Crystal structure of the oxidized gamma-subunit of the dissimilatory sulfite reductase (DsrC) from Archaeoglobus fulgidus

1. Protein Identity and Related Structures Protein Identity & Related Structures

sulfite reductase, desulfoviridin-type subunit gamma (dsvC)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2a5w__assembly_3__model_1

2a5w__assembly_3__model_1 | I(q)

2a5w__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (3 domains)

CATH v4.4 (6 domains)

7. Citations (1)